Identifiers and Description

Gene Model Identifier

TTHERM_00501000

Standard Name

TNT1 (tRNA-nucleotidyltransferase 1)

Aliases

PreTt08044 | 63.m00222 | 3716.m00075

Description

tRNA-nucleotidyltransferase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR01942 ) poly(A) polymerase
  • ( TIGR02692 ) tRNA adenylyltransferase
  • ( PF01743 ) tRNA nucleotidyltransferase/poly(A) polymerase family protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00501000

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09625.19.997093137033517e-262polyA polymerase (572 aa)
SGDYER168C5.0023264312997875e-87CCA1 ATP (CTP):tRNA-specific t
RNA nucleotidyltransferase; di
fferent forms targeted to the
nucleus, cytosol, and mitochon
drion are generated via the us
e of multiple transcriptional
and translational start sites
DictyBaseDDB_G02935041.999469658314961e-75DDB_G0293504 on chromosome: 6
position 2968920 to 2970687
OxytrichaContig19735.0.g243.9983507938127826e-75Poly A polymerase head domain
Stentor CoeruleusSteCoe_137508.194012623990515e-40
WormBaseWBGene000100890.00000000000009996062864481225locus:hpo-31 status:Confirme
d UniProt:Q93795 protein_i
d:CAB02125.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00501000(coding)
ATGATTAGCTTTATTGGTAAAAATCAAATTAAATAGTTTTTTAGTCTCAATTTTAATATA
AACAGATAATATAATAAACAATTAAAATATCATTAAAAAGCATAATCCTAGTTTGAAGGA
AAAAGTAATCAAAATATAATTAAAATATATTAGCAAGAATAATAAAGACACCTATTTTAC
TAAGGATAGTATTCATTTAATAGATTAAGAGCTTGTGCAAGAAGGATGGAAATAGAATCT
GATATTAAAATTACTTTAAATGAAAAAGAAAAGTAATTATTTGACTTTTTACTAGAATTT
GTTAAAGCCAAAAATATATAAGTAGTACTTCGTTCAGCTGGAGGTTGGGTTCGTGATAAG
ATTTTAGGCTAAGAATGTCATGATATTGATATTACATTAGATACTATGACTGGTGAGTAG
TTTATTAACTTATTGATTGACTACCTCAAGGAAAAGGGTTAGGAAGACCTTATATCAGGT
CATGGTGTTATTAAAAGTAACCCTGATAAATCTAAGCATTTAGAAACAGTCACTTTCAAA
ATTTTTGGATACGACATTGATATCGCTAATTTAAGACATGAAGAATATACAAAATCTAGA
ATTCCTACTATGAAATTTGGTACTCCACTTTAAGATGCTGAAAGAAGAGATTTAACAATA
AATTCAATGTTCTACAATATTAATACTTGTTAAATAGAAGATTTTACAGGTAAAGGTCTT
AGTGATCTTTAAAACAAAATCATCAGAACTCCATTAGATCCTACATAAACCTTTATTGAT
GATCCCTTGAGAATTTTGAGAACATTTAGATTCGCAACAAAGTATTCTTTTTCAATAGTT
CCAGACATTATTGAAGCACTTAAATAAGAATAAATAAGAATTAGTTTAGAAGAAAAAGTT
AGCAGAGAAAGAATAAGAACTGAGCTTGAAAAAATATTGAAAGATAAGAATGTGGAGATA
GGATTGAACTTAATATTCTAAAATAATTTATGGTCAATTGTATTCTAGATGCCAGATAAA
TGTGACGAATTGAAAGATAAAGTGTTCTATGATTAAAAATAACTAGAATCATATAACCTT
GCAATCAGATCAGTTTAAGAACTAAAAACTGTATAAGATATGCCCATTTTATCACAGGAC
TTCTAATAATAAGATGTTTAATTATTATTCTTAATGTCTGCTATTTCTTTCCCATTCGCT
AAAATTTAGTATAAAATTAATAAAACAATAATGTCTCTTCCTCAATATTTAGCTTTTGAA
TCCCTTAAATTCCCTGATAAAGCCTTGAAGGTTTGCACTATTATAACTCAAACTTGTGAA
AATGCTCTCAAGATTTAAGAAATTATTAAGAAAAATTTCGATGAAGAATTTAATAATATA
GCTCAACTAATTAAAAAGCTAGGAAATACATGGGAGCTCGCGTTTTCTATTGCTAGAATA
AGTGACTCTATCTAATTCAAGGATGAATTTTCCTCAAGTTATGATAAGTTAATTGAGTTT
ATTTATTTTAACAAAATCGAAAAAGTATATGCAATGAAACCTTTAATTGACGGTAAAGAA
ATTATGGGAATATTTGAACTGGATAAGTAAGGCCCTGTTGTAGGAAAAATTAATACAAAC
ATCTTTCTTTGGTAAGCTAAAAATATGGATAAGTAGAAGGATGACTTAATAGCAGAAATA
GTTAAAAATAAATAAAAGTTTATGTTATGA


>TTHERM_00501000(protein)
MISFIGKNQIKQFFSLNFNINRQYNKQLKYHQKAQSQFEGKSNQNIIKIYQQEQQRHLFY
QGQYSFNRLRACARRMEIESDIKITLNEKEKQLFDFLLEFVKAKNIQVVLRSAGGWVRDK
ILGQECHDIDITLDTMTGEQFINLLIDYLKEKGQEDLISGHGVIKSNPDKSKHLETVTFK
IFGYDIDIANLRHEEYTKSRIPTMKFGTPLQDAERRDLTINSMFYNINTCQIEDFTGKGL
SDLQNKIIRTPLDPTQTFIDDPLRILRTFRFATKYSFSIVPDIIEALKQEQIRISLEEKV
SRERIRTELEKILKDKNVEIGLNLIFQNNLWSIVFQMPDKCDELKDKVFYDQKQLESYNL
AIRSVQELKTVQDMPILSQDFQQQDVQLLFLMSAISFPFAKIQYKINKTIMSLPQYLAFE
SLKFPDKALKVCTIITQTCENALKIQEIIKKNFDEEFNNIAQLIKKLGNTWELAFSIARI
SDSIQFKDEFSSSYDKLIEFIYFNKIEKVYAMKPLIDGKEIMGIFELDKQGPVVGKINTN
IFLWQAKNMDKQKDDLIAEIVKNKQKFML


>TTHERM_00501000(gene)
GGATAATTAAAATATCTAATAAAATTTCATATCTTCATAAGTAAATGATTAGCTTTATTG
GTAAAAATCAAATTAAATAGTTTTTTAGTCTCAATTTTAATATAAACAGATAATATAATA
AACAATTAAAATATCATTAAAAAGCATAATCCTAGTTTGAAGGAAAAAGTAATCAAAATA
TAATTAAAATATATTAGCAAGAATAATAAAGACACCTATTTTACTAAGGATAGTATTCAT
TTAATAGATTAAGAGCTTGTGCAAGAAGGATGGAAATAGAATCTGATATTAAAATTACTT
TAAATGAAAAAGAAAAGTAATTATTTGACTTTTTACTAGAATTTGTTAAAGCCAAAAATA
TATAAGTAGTACTTCGTTCAGCTGGAGGTTGGGTTCGTGATAAGGTAAAATTTTTTATTT
AAATCAAAATACAATTTTATTTTTTACTTTTATTTAATGATTTTTCTTAAAAATATTTTT
GTATTTAACTCCAGATTTTAGGCTAAGAATGTCATGATATTGATATTACATTAGATACTA
TGACTGGTGAGTAGTTTATTAACTTATTGATTGACTACCTCAAGGAAAAGGGTTAGGAAG
ACCTTATATCAGGTCATGGTGTTATTAAAAGTAACCCTGATAAATCTAAGCATTTAGAAA
CAGTCACTTTCAAAATTTTTGGATACGACATTGATATCGCTAATTTAAGACATGAAGAAT
ATACAAAATCTAGAATTCCTACTATGGTAATCAAAATTTACATTCAAAAAGACTAAACTT
AATGAAAAAATAATGCAAATAATATTAAAAGAAATTTGGTACTCCACTTTAAGATGCTGA
AAGAAGAGATTTAACAATAAATTCAATGTTCTACAATATTAATACTTGTTAAATAGAAGA
TTTTACAGGTAAAGGTCTTAGTGATCTTTAAAACAAAATCATCAGAACTCCATTAGATCC
TACATAAGTAAATAGCTTGAAATATTAAGTTGAAATTAATTTAATAATAAATAAAGACCT
TTATTGATGATCCCTTGAGAATTTTGAGAACATTTAGATTCGCAACAAAGTATTCTTTTT
CAATAGTTCCAGACATTATTGAAGCACTTAAATAAGAATAAATAAGAGTATTAAATTTTT
GTATCTTTTACTAACTTATTTATTATTAATTAAAATAAAAAAATAGATTAGTTTAGAAGA
AAAAGTTAGCAGAGAAAGAATAAGAACTGAGCTTGAAAAAATATTGAAAGATAAGAATGT
GGAGATAGGATTGAACTTAATATTCTAAAATAATTTATGGTCAATTGTATTCTAGATGCC
AGATAAATGTGACGAATTGAAAGATAAAGTGTTCTATGATTAAAAATAACTAGAATCATA
TAACCTTGCAATCAGATCAGTTTAAGAACTAAAAACTGTATAAGATATGCCCATTTTATC
ACAGGACTTCTAATAATAAGATGTTTAATTATTATTCTTAATGTCTGCTATTTCTTTCCC
ATTCGCTAAAATTTAGTATAAAATTAATAAAACAATAATGTCTCTTCCTCAATATTTAGC
TTTTGAATCCCTTAAAGTAATTAATTAATTAAAAAATTATTACATTAAATATAAAAATTC
ATAAAAAATATTTTTCATAGTTCCCTGATAAAGCCTTGAAGGTTTGCACTATTATAACTC
AAACTTGTGAAAATGCTCTCAAGATTTAAGAAATTATTAAGAAAAATTTCGATGAAGAAT
TTAATAATATAGCTCAACTAATTAAAAAGCTAGGAAATACATGGGAGCTCGCGTTTTCTA
TTGCTAGAATAAGTGACTCTATCTAATTCAAGGATGAATTTTCCTCAAGTTATGATAAGT
TAATTGAGTTTATTTATTTTAACAAAATCGAAAAAGTATATGCAATGAAACCTTTAATTG
ACGTAAAAAATTAATAAATAAATATGGATCTAAAGTAATATTTATATCTTCTTTTTAACT
TAAATTAGGGTAAAGAAATTATGGGAATATTTGAACTGGATAAGTAAGGCCCTGTTGTAG
GAAAAATTAATACAAACATCTTTCTTTGGTAAGCTAAAAATATGGATAAGTAGAAGGATG
ACTTAATAGCAGAAATAGTTAAAAATAAATAAAAGTTTATGTTATGATTCTTAATTATCA
AAAATAAAAATAATTTATTTCAATATTTTTTATTAATTCTAACAATTTTGTCTATCTATA
TATTAAATTATTTTATTTATTTTTATGATTTCTCTTTAATATTTGATTGAATTTATCAGA
AAATAAAGCTTAAATTTTCATAAA