Identifiers and Description

Gene Model Identifier

TTHERM_00127000

Standard Name

TMLH1 (Tetrahymena homolog of budding yeast MLH1)

Aliases

PreTt09363 | 9.m00384 | 3699.m00093

Description

DNA mismatch repair protein, C-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR00585 ) DNA mismatch repair protein MutL
  • ( PF01119 ) DNA mismatch repair protein, C-terminal
  • ( PF02518 ) ATPase, histidine kinase-, DNA gyrase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00127000

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09117.19.997093137033517e-262DNA mismatch repair protein do
main-containing protein (747 a
a)
SGDYMR167W8.999119107228014e-72MLH1 Protein required for mism
atch repair in mitosis and mei
osis as well as crossing over
during meiosis; forms a comple
x with Pms1p and Msh2p-Msh3p d
uring mismatch repair; human h
omolog is associated with here
ditary non-polyposis colon can
cer
DictyBaseDDB_G02873939.999565105288807e-71mlh1 on chromosome: 5 position
247623 to 250277
OxytrichaContig14864.0.g426.9991332754409754e-68DNA mismatch repair protein, C
-terminal domain
WormBaseWBGene000033739.004195835458823e-61locus:mlh-1 status:Confirmed
UniProt:Q9XU10 protein_id
:CAB07283.2
Stentor CoeruleusSteCoe_235472.3802664086944007e-26

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23935123: Lukaszewicz A, Howard-Till RA, Loidl J (2013) Mus81 nuclease and Sgs1 helicase are essential for meiotic recombination in a protist lacking a synaptonemal complex. Nucleic acids research 41(20):9296-309

Sequences

>TTHERM_00127000(coding)
ATGAATCATTCCTAACCCTTAGAAAATACTGGTCCTCAGATCAAGAAGCTCCCATAAGAG
CTTATCGATAAGATTGCAGCTGGTGAAGTAGTACAACGTCCATCTGCAGCTGTTAAGGAG
CTTATTGAGAACTGTCTTGATGCTGGATCAAGTGAAATTTCAGTAGGGTTAGTATAAGGA
GGGTTAAAGTAGCTTATTGTAGAAGATAATGGTTCTGGAATTCACAAAGACGATTTTCCA
CTTCTCTGCGAAAGGTTTGCTACCTCTAAGATAAATGAGTTTAATGACCTTTAGAGTTTA
GTTTCATTTGGCTTTAGAGGAGAAGCGTTAGCCTCTATTTCTTTTGTCTCCAACTTGAAA
ATCACATCTCGAAAACCTAATTCTGACCTAGGATATAAAGCTAGTTTCAAAAACGGTGTT
ATGCTTGGTGAAGAGCCTGAAGCAGTGAACTGTACTGAAGGGACTACAGTAGATGTCTAG
GATTTATTTTTTAACTATGATGCAAGGAGAAAAAGTTTAAATGTTAACGAAGAAAAAAAA
AGAGTACTCAAATTGATCGGACAATTTGCTATGCATCATGCTAAATTGAGATTTAAATTT
AAAAGTGATAACCAAATTCAATTCTCATCTCACAGTGTGCTTGGCTCTACAGAATTGCAA
AGAAGAGAATAAATTATGTAGCAAATTACTAAGATTGCAGATAAAAGCTTTACTTCATGT
GAAAGTGAGTCGACAGAATATTAAGTTAAATTTAAAGGAACTTTTTCCAACATTGGAGCT
ACTAAAAAATACAAAGAAATCACTCTCTTTATAAATAATCGTTTGGTTGAATGTGAATCT
ATCAAAAAAGCAGTAGAACGCTCTTACCAGTCTTGTTATTAAAGTATTCATGAAGAAGAA
GGTGGATATTTTTGCTACTTGAGCTTAGAAATGAATCCAAAGAACTTGGATCCTAATGTT
CACCCAACAAAAAAAGAAGTCAAATTCTTATTTGAGTACGAAATAGCAAAAGAAATTGAA
TCATGGATTTTCGAAAATTTGAAAAATTGTGGAGTTATCAAACAACTTTCAGCAAATATT
TCATAAAGAACATCTTCATTTGAAACTTCAAATGTGAAAAGAAGTAGCTCAAGTCAATTA
TATTTTGGTTCTTAGAGCAATTTATCTAAGCAAAATTCTGATTACTATCAACCCACCAAG
CAAATTCGTGTAGATCCCAGAGATTAGAAAATTACTAGATTCTTTTCAGTAGAAAGCTCT
GAAGATGGAAATAACAATTCAAATCAAAAAAATTATCAAAGTATTAATTATATTGAAGAG
CAGAAAGAAGAACATCTAAACAGTCAAGATGATATTGCTGAAGAACCTGTTGATATGATT
AAAAAGAAAAAGATGCTCAATGAAGAAAGAAATTAAACTTCAATCAGTAATATAGGAAGC
TCTGACTAATTAGATGCTAATAATGCTCGTTCAAGTGTCATCGATAGGGCAAATTCTTAA
GTTAATGACCCACGTATTTAAGTATAATAATAGTTATTGTCTTTAAGGAATCAAGATATC
CATGATACAACAAGTTCTTTCTTTAAAAATCTTACGTATGTTGGCTGTATTTCTTCTAAT
CACTTTCTAGCTCAATTTAGAGATGATCTCTACCTTATAAACTCTATTCCATTATGTTAA
GAAATATTTAAATTTGAAATTCTGAGAAACTTTGGATAGATTAAGCCTGTAGAGCTAAAT
TAAGCAATAGGTTTGAAGGATATTTTAGAGTATTTTTTATTAAATTTTGATGAGATACCG
AATGAGAAAAAGGAGTTCCATCTGTCAAATATGGATACTTACATCGAGTAATTTGGCTTA
TTGAGTGACTTTTTAAGAGACTCCGTAGGCATAGTCATCAAAGATTAAAAGCTCTTGGCT
TTCCCTAATTTATTTAATTTATTTGAAAATGATAATAACTTTAAAGATATCTCATACATT
CTGTTGAGAATAATCACCAAAGTTAATTTTAGCGAAATACTCTAATCAGGTATGGGCTTA
GCAAACGAATTATCATTCTACTTTGCTTGGCAATTAGAAAAATCGTTTAAAAATTAATTG
TAAAGACAGCATTTCTAGGAAACGCAAAAGCAGAAATGGGACGATTTCTTTGAATAAAAA
ATGCTCCCAATGATTAAAAAAAAACTTTCACTCCCTAAATTAGATATTAGCGAGTTTACA
GTTAAGCTATTTAAGCAAGAAGATGCATACAAGATCTTCGAAAGATGTTGA


>TTHERM_00127000(protein)
MNHSQPLENTGPQIKKLPQELIDKIAAGEVVQRPSAAVKELIENCLDAGSSEISVGLVQG
GLKQLIVEDNGSGIHKDDFPLLCERFATSKINEFNDLQSLVSFGFRGEALASISFVSNLK
ITSRKPNSDLGYKASFKNGVMLGEEPEAVNCTEGTTVDVQDLFFNYDARRKSLNVNEEKK
RVLKLIGQFAMHHAKLRFKFKSDNQIQFSSHSVLGSTELQRREQIMQQITKIADKSFTSC
ESESTEYQVKFKGTFSNIGATKKYKEITLFINNRLVECESIKKAVERSYQSCYQSIHEEE
GGYFCYLSLEMNPKNLDPNVHPTKKEVKFLFEYEIAKEIESWIFENLKNCGVIKQLSANI
SQRTSSFETSNVKRSSSSQLYFGSQSNLSKQNSDYYQPTKQIRVDPRDQKITRFFSVESS
EDGNNNSNQKNYQSINYIEEQKEEHLNSQDDIAEEPVDMIKKKKMLNEERNQTSISNIGS
SDQLDANNARSSVIDRANSQVNDPRIQVQQQLLSLRNQDIHDTTSSFFKNLTYVGCISSN
HFLAQFRDDLYLINSIPLCQEIFKFEILRNFGQIKPVELNQAIGLKDILEYFLLNFDEIP
NEKKEFHLSNMDTYIEQFGLLSDFLRDSVGIVIKDQKLLAFPNLFNLFENDNNFKDISYI
LLRIITKVNFSEILQSGMGLANELSFYFAWQLEKSFKNQLQRQHFQETQKQKWDDFFEQK
MLPMIKKKLSLPKLDISEFTVKLFKQEDAYKIFERC


>TTHERM_00127000(gene)
ATGAATCATTCCTAACCCTTAGAAAATACTGGTCCTCAGATCAAGAAGCTCCCATAAGAG
CTTATCGATAAGATTGCAGCTGGTGAAGTAGTACAACGTCCATCTGCAGGTATTTGAATC
CGTCCTTTTCTATTTTTCAATATCCTGATGATAGTTTCTTTCAAATCAAAGCATCACTTC
TTTGATTAAATAATTATCATATATCATTAAGCAGATTATTAATATCAAGAAATAAATATG
GGTTTTTAAAATTAAATTTTGCATTCCATTTTTCCTACGCTAGAAATCTAATTAAAGAAT
TTTTATTGCTGAATATTTTGTAGAAGTTATGATGCATTTTATTTACCCAATAAACTGTTT
GCTCTCATCAGCTTAAATTTAGAGTAAAATTAAGCTGCTTGCTATTCCTGATTATTTTCT
TTAGTATAAATTAGATTTTCAGTAAATTTAGGAATATTGTTTGTTTAGTATTTTAACATA
CAATAAATAATAAGGGCAAATAAATATGTTAGTTAACAAATGAAAGGACATAAAGGAGTT
GATTAAATGAAAGGATAAAATTTTAATTGATCATTTTATTAAATTTTTTTGTTTATTTAT
AATTAATTATAGCTGTTAAGGAGCTTATTGAGAACTGTCTTGATGCTGGATCAAGTGAAA
TTTCAGTAGGGTTAGTATAAGGAGGGTTAAAGTAGCTTATTGTAGAAGATAATGGTTCTG
GAATTCACAAAGACGATTTTCCACTTCTCTGCGAAAGGTTTGCTACCTCTAAGATAAATG
AGTTTAATGACCTTTAGAGTTTAGTTTCATTTGGCTTTAGAGGAGAAGCGTTAGCCTCTA
TTTCTTTTGTCTCCAACTTGAAAATCACATCTCGAAAACCTAATTCTGACCTAGGATATA
AAGCTAGTTTCAAAAACGGTGTTATGCTTGGTGAAGAGCCTGAAGCAGTGAACTGTACTG
AAGGGACTACAGTAGATGTCTAGGATTTATTTTTTAACTATGATGCAAGGTAAATTCAAT
TATAAATTAAAAATATGTTGTTGAAATAACAATTATCGCGTTAAAGCCATTCATTCATTT
ATCATAAAATCAAAATACTAATATATATTTTGATAATTTTCAAGAAAAATTTATAGTTTA
GAAACAAAGGTGTTAAAATTTTGTCATTCAATCAATCAATTTTCATTAATTTGATTACTA
TTTAATGTTTATTTCTCTCTCATTAACATTCATTTTAATGGCAATTAATCATTCATAATT
CTCAAATAAATTCTTCTTAAAGCTACGAAAATATTTAATTCTAGTAAAAGTGTATTGAAA
AAGGCTTGAACATATAAAAATATTTTTAATTCCTTCAAAGATTAACAGAAAGTTAGCAAA
AATAATTTATAGTTTTATACTTTTAAGGTGTTTAATTAATTGAATCAACCATAGCAAAGC
AAAAATAACAGCCCAATTTAGATAGCTTTTTTATTTAAAAATGCAAACAATATTATACAG
TTTATAAATGCTGCTCTGTAGCTATTGAAGAGAAAGAGAGAGATTTATTTTTGGCTGTTA
TGAATTGAATGAAATTGATAATGATAATTGAGATTAGAAAGTAAGTATTATTAAATAAAA
TAGGGGGTCTACGAATATTCGAAAGAATTATAATCAATTGGCTTTACTTTTTTTTTCTTT
TTGATTTAGAAGGTGAAAGTAAATTTACAAAATATGTTAATAGAGATAAAAATTTTTGGT
ATTTCCTTCAGCTTACGTTAATTTATTTAATTTAAATGCAAATAAATTACTAAAACTTAA
TACCTTGCCATTTTTGGAAGTAAAGAAATAAATAAAAAAATATAATTTTGAAGAAATCCT
TTTTATCTTTTTAATTTTCCTAAATTTTATCTTCTAATTCAATAATTTTGAATGAATGAT
TTCTTTGCCACTAATAAAAATTAAGTTTTGAGATAGAAATAAAATAATTAAATTGATTTA
GATTATTATTAAATTAATGAATGCGCACAATTTTTTTTTATAAATGAATTAATATTTGAC
TCAATCAATCAACCTAAACTAAAAACTCTACCCAGTTGATTATTTTTTATATCTACTAAT
TATTAATTTAAATTTCTTGTTCGTTCACCCATAAAACAAACAAAAAAGTTTTTACTTTAA
ACCAAATATTTTAAAATATTGTCCACGTAATTAAATAACAAAGGGTTATTTTAATATTAA
TAATTATAAATATATTCATTGATTAATACACTCATAATAAATACCTTCTACTTTATAAAA
AATATAATTAATTAATTAATTAATTAAATAAATAAATTTCTCACTTTAACTTATAATTCT
ATTTTAAATAATTAGGAGAAAAAGTTTAAATGTTAACGAAGAAAAAAAAAGAGTACTCAA
ATTGATCGGACAATTTGCTATGCATCATGCTAAATTGAGATTTAAATTTAAAAGTGATAA
CCAAATTCAATTCTCATCTCACAGTGTGCTTGGCTCTACAGAATTGCAAGTAAACTTTCG
TAAACATTAAATACATTTTAATTAATTCTAATTAAATTCTAGAGAAGAGAATAAATTATG
TAGCAAATTACTAAGATTGCAGATAAAAGCTTTACTTCATGTGAAAGTGAGTCGACAGAA
TATTAAGTTAAATTTAAAGGAACTTTTTCCAACATTGGAGCTACTAAAAAATACAAAGAA
ATCACTCTCTTTATAAATAATCGTTTGGTTGAATGTGAATCTATCAAAAAAGCAGTAGAA
CGCTCTTACCAGTCTTGTTATTAAGTAAAACCTTTTTACCTAATTAACTAATGAGATTTA
ATCAACAATTTTAATTATCATTAGAACTGCTTTAAATTTAATTTTATATAATAATTACAT
AACAATAATAATAATATATATATAGAGTATTCATGAAGAAGAAGGTGGATATTTTTGCTA
CTTGAGCTTAGAAATGAATCCAAAGAACTTGGATCCTAATGTTCACCCAACAAAAAAAGA
AGTCAAATTCTTATTTGAGTACGAAATAGCAAAAGAAATTGAATCATGGATTTTCGAAAA
TTTGAAAAATTGTGGAGTTATCAAACAACTTTCAGCAAATATTTCATAAAGAACATCTTC
ATTTGAAACTTCAAATGTGAAAAGAAGTAGCTCAAGTCAATTATATTTTGGTTCTTAGAG
CAATTTATCTAAGCAAAATTCTGATTACTATCAACCCACCAAGCAAATTCGTGTAGATCC
CAGAGATTAGAAAATTACTAGATTCTTTTCAGTAGAAAGCTCTGAAGATGGAAATAACAA
TTCAAATCAAAAAAATTATCAAAGTATTAATTATATTGAAGAGCAGAAAGAAGAACATCT
AAACAGTCAAGATGATATTGCTGAAGAACCTGTTGATATGATTAAAAAGAAAAAGATGCT
CAATGAAGAAAGAAATTAAACTTCAATCAGTAATATAGGAAGCTCTGACTAATTAGATGC
TAATAATGCTCGTTCAAGTGTCATCGATAGGGCAAATTCTTAAGTTAATGACCCACGTAT
TTAAGTATAATAATAGTTATTGTCTTTAAGGAATCAAGATATCCATGATACAACAAGTTC
TTTCTTTAAAAATCTTACGTATGTTGGCTGTATTTCTTCTAATCACTTTCTAGCTCAATT
TAGAGATGATCTCTACCTTATAAACTCTATTCCATTATGGTAAATTCATCTTTAAATCAT
TCGCTCTTTCTTTTAAATTTTAATGGAAACAAAAAAATAAACCAAAATATTTATTTATCA
TTTTAGAAACATTTTTTTGATTTTAATAACCAAAATATTTATTTTAAAAAAAGTTAAGAA
ATATTTAAATTTGAAATTCTGAGAAACTTTGGATAGATTAAGCCTGTAGAGCTAAATTAA
GCAATAGGTTTGAAGGATATTTTAGAGTATTTTTTATTAAATTTTGATGAGATACCGAAT
GAGAAAAAGGAGTTCCATCTGTCAAATATGGATGTATGTTAGTTATTTGTTAATTTTATC
AATAAATAAAATATTTTGATTAAAATTAGACTTACATCGAGTAATTTGGCTTATTGAGTG
ACTTTTTAAGAGACTCCGTAGGCATAGTCATCAAAGATTAAAAGCTCTTGGCTTTCCCTA
ATTTATTTAATTTATTTGAAAATGATAATAACTTTAAAGATATCTCATACATTCTGTTGA
GAATAATCACCAAAGTAAATAAATAAATAAAAAGCTATTTGCTTATTTACAAACAATATA
TAATAAACTTTTTAAATTCAAAGGTTAATTTTAGCGAAATACTCTAATCAGGTATGGGCT
TAGCAAACGAATTATCATTCTACTTTGCTTGGCAATTAGAAAAATCGTTTAAAAATTAAT
TGTAAAGACAGCATTTCTAGGAAACGCAAAAGCAGAAATGGGACGATTTCTTTGAATAAA
AAATGCTCCCAATGATTAAAAAAAAACTTTCACTCCCTAAATTAGATATTAGCGAGTTTA
CAGTTAAGCTATTTAAGCAAGAAGATGCATACAAGATCTTCGAAAGATGTTGA