Identifiers and Description

Gene Model Identifier

TTHERM_00263130

Standard Name

TMK1 (dTMP kinase)

Aliases

PreTt29378 | 23.m00274

Description

TMK1 thymidylate kinase; Thymidylate and uridylate kinase- functions in de novo biosynthesis of pyrimidine deoxyribonucleotides

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.2%

TetraMine Data

TTHERM_00263130

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06447.19.995516318087232e-125thymidylate kinase (212 aa)
DictyBaseDDB_G02900339.999353957415832e-59dtymk on chromosome: 5 positio
n 3573621 to 3574420
OxytrichaContig7706.0.g428.998068369452149e-53Thymidylate kinase
SGDYJR057W6.002971818577897e-50CDC8 Thymidylate and uridylate
kinase, functions in de novo
biosynthesis of pyrimidine deo
xyribonucleotides; converts dT
MP to dTDP and dUMP to dUTP; e
ssential for mitotic and meiot
ic DNA replication; homologous
to S. pombe Tmp1p
WormBaseWBGene000112722.000364041471746e-45Probable thymidylate kinase
status:Confirmed UniProt:Q22
018 protein_id:CAA91347.1
Stentor CoeruleusSteCoe_308407.095474162284704e-23

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00263130(coding)
ATGAGCAAAAGAGGACTCTTTATAGTTTTTGAAGGATTAGATAGATGTGGAAAGACATCC
TAATGCGAGAATTTAGTTAACTTTTTAAAAGAAAGTGGAAAAAAAGCAATTATGAAGAGA
TATCCTGACAGAACTACAACCATTGGCCAAACTATCAATAATTATCTTTAAGGAAAGTAG
AATTTAAGCGACTAGGCAATTCATTTGATTTTTTCAGCTAATCGTTGGGAATAATAAGAA
GAAATTAAGAAGATTTTAGATGAAGGAACCAATATTGTTTGTGATAGGTATTGTTATTCA
GGAGCAGTTTATACATCAGCTAAGGGTTATGACATAGAATGGTGCAAAAATCCTGATAAA
GGTTTAATAAAGCCTGATATTGTTTTATACTTGCACGCTCCTAAAGAGGTTATTTCAAAA
AGATCAGGATTTGGTGGTGAAGTGTATGAGAAAGAAGAATTTTAATAAAAAGTAAGGGAA
GCATTTGATAATCTGCTCTAAAAAGAAGATAATGTAGTTTTTATTGATGCTAGTGGAACA
AAGGAAGAAGTATTCGATTTAATAAACTAAAATATAAAAAAGGTATTTGAGGATGCTTCT
ACAAAAGACTAAAAAATATCCCATTTATGGATATGA


>TTHERM_00263130(protein)
MSKRGLFIVFEGLDRCGKTSQCENLVNFLKESGKKAIMKRYPDRTTTIGQTINNYLQGKQ
NLSDQAIHLIFSANRWEQQEEIKKILDEGTNIVCDRYCYSGAVYTSAKGYDIEWCKNPDK
GLIKPDIVLYLHAPKEVISKRSGFGGEVYEKEEFQQKVREAFDNLLQKEDNVVFIDASGT
KEEVFDLINQNIKKVFEDASTKDQKISHLWI


>TTHERM_00263130(gene)
ATGAGCAAAAGAGGACTCTTTATAGTTTTTGAAGGATTAGATAGATGTGGAAAGACATCC
TAATGCGAGAATTTAGTTAACTTTTTAAAAGAAAGTGGAAAAAAAGCAATTATGAAGAGA
TATCCTGACAGAACTACAACCATTGGCCAAACTATCAATAATTATCTTTAAGGAAAGTAG
AATTTAAGCGACTAGGCAATTCATTTGATTTTTTCAGCTAATCGTTGGGAATAATAAGAA
GAAATTAAGAAGATTTTAGATGAAGGAACCAATATTGTTTGTGATAGGTATTGTTATTCA
GGAGCAGTTTATACATCAGCTAAGGTAGATAATATTTCTTATTGCATTTTTTATTTAATA
AAAAATTGAAATGATTGATCTTATTCTTTTTTTTCAAAAGGGTTATGACATAGAATGGTG
CAAAAATCCTGATAAAGGTTTAATAAAGCCTGATATTGTTTTATACTTGCACGCTCCTAA
AGAGGTTATTTCAAAAAGATCAGGATTTGGTGGTGAAGTGTATGAGAAAGAAGAATTTTA
ATAAAAAGTAAGGGAAGCATTTGATAATCTGCTCTAAAAAGAAGATAATGTAGTTTTTAT
TGATGCTAGTGGAACAAAGGAAGAAGTATTCGATTTAATAAACTAAAATATAAAAAAGGT
ATTTGAGGATGCTTCTACAAAAGACTAAAAAATATCCCATTTATGGATATGA