Identifiers and Description

Gene Model Identifier

TTHERM_00263130

Standard Name

TMK1 (dTMP kinase)

Aliases

PreTt29378 | 23.m00274

Description

Thymidylate and uridylate kinase, functions in de novo biosynthesis of pyrimidine deoxyribonucleotides

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.2%

TetraMine Data

TTHERM_00263130

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06447.19.995516318087232e-125thymidylate kinase (212 aa)
DictyBaseDDB_G02900339.999353957415832e-59dtymk on chromosome: 5 positio
n 3573621 to 3574420
OxytrichaContig7706.0.g428.998068369452149e-53Thymidylate kinase
SGDYJR057W6.002971818577897e-50CDC8 Thymidylate and uridylate
kinase, functions in de novo
biosynthesis of pyrimidine deo
xyribonucleotides; converts dT
MP to dTDP and dUMP to dUTP; e
ssential for mitotic and meiot
ic DNA replication; homologous
to S. pombe Tmp1p
WormBaseWBGene000112722.000364041471746e-45Probable thymidylate kinase
status:Confirmed UniProt:Q22
018 protein_id:CAA91347.1
Stentor CoeruleusSteCoe_308407.095474162284704e-23

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00263130(coding)
ATGAGCAAAAGAGGACTCTTTATAGTTTTTGAAGGATTAGATAGATGTGGAAAGACATCC
TAATGCGAGAATTTAGTTAACTTTTTAAAAGAAAGTGGAAAAAAAGCAATTATGAAGAGA
TATCCTGACAGAACTACAACCATTGGCCAAACTATCAATAATTATCTTTAAGGAAAGTAG
AATTTAAGCGACTAGGCAATTCATTTGATTTTTTCAGCTAATCGTTGGGAATAATAAGAA
GAAATTAAGAAGATTTTAGATGAAGGAACCAATATTGTTTGTGATAGGTATTGTTATTCA
GGAGCAGTTTATACATCAGCTAAGGGTTATGACATAGAATGGTGCAAAAATCCTGATAAA
GGTTTAATAAAGCCTGATATTGTTTTATACTTGCACGCTCCTAAAGAGGTTATTTCAAAA
AGATCAGGATTTGGTGGTGAAGTGTATGAGAAAGAAGAATTTTAATAAAAAGTAAGGGAA
GCATTTGATAATCTGCTCTAAAAAGAAGATAATGTAGTTTTTATTGATGCTAGTGGAACA
AAGGAAGAAGTATTCGATTTAATAAACTAAAATATAAAAAAGGTATTTGAGGATGCTTCT
ACAAAAGACTAAAAAATATCCCATTTATGGATATGA


>TTHERM_00263130(protein)
MSKRGLFIVFEGLDRCGKTSQCENLVNFLKESGKKAIMKRYPDRTTTIGQTINNYLQGKQ
NLSDQAIHLIFSANRWEQQEEIKKILDEGTNIVCDRYCYSGAVYTSAKGYDIEWCKNPDK
GLIKPDIVLYLHAPKEVISKRSGFGGEVYEKEEFQQKVREAFDNLLQKEDNVVFIDASGT
KEEVFDLINQNIKKVFEDASTKDQKISHLWI


>TTHERM_00263130(gene)
ATGAGCAAAAGAGGACTCTTTATAGTTTTTGAAGGATTAGATAGATGTGGAAAGACATCC
TAATGCGAGAATTTAGTTAACTTTTTAAAAGAAAGTGGAAAAAAAGCAATTATGAAGAGA
TATCCTGACAGAACTACAACCATTGGCCAAACTATCAATAATTATCTTTAAGGAAAGTAG
AATTTAAGCGACTAGGCAATTCATTTGATTTTTTCAGCTAATCGTTGGGAATAATAAGAA
GAAATTAAGAAGATTTTAGATGAAGGAACCAATATTGTTTGTGATAGGTATTGTTATTCA
GGAGCAGTTTATACATCAGCTAAGGTAGATAATATTTCTTATTGCATTTTTTATTTAATA
AAAAATTGAAATGATTGATCTTATTCTTTTTTTTCAAAAGGGTTATGACATAGAATGGTG
CAAAAATCCTGATAAAGGTTTAATAAAGCCTGATATTGTTTTATACTTGCACGCTCCTAA
AGAGGTTATTTCAAAAAGATCAGGATTTGGTGGTGAAGTGTATGAGAAAGAAGAATTTTA
ATAAAAAGTAAGGGAAGCATTTGATAATCTGCTCTAAAAAGAAGATAATGTAGTTTTTAT
TGATGCTAGTGGAACAAAGGAAGAAGTATTCGATTTAATAAACTAAAATATAAAAAAGGT
ATTTGAGGATGCTTCTACAAAAGACTAAAAAATATCCCATTTATGGATATGA