Identifiers and Description

Gene Model Identifier

TTHERM_00492460

Standard Name

TKU80 (Tetrahymena Ku80 orthologue )

Aliases

PreTt04182 | 61.m00169 | 3711.m00017

Description

Ku70/Ku80 beta-barrel domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • double-strand break repair via nonhomologous end joining (IEA) | GO:0006303

Domains

  • ( PF04212 ) MIT domain
  • ( TIGR02772 ) Ku protein
  • ( PF08785 ) Ku C terminal domain like
  • ( PF02735 ) Ku70/Ku80 beta-barrel domain
  • ( PF00092 ) von Willebrand factor type A
  • ( PF03731 ) Ku70/Ku80 N-terminal alpha/beta domain
  • ( TIGR00578 ) ATP-dependent DNA helicase ii, 70

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 17%

TetraMine Data

TTHERM_00492460

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12939.19.997093137033517e-262Ku70/Ku80 beta-barrel domain-c
ontaining protein (759 aa)
OxytrichaContig9679.0.g875.999773492405769e-126Ku C terminal domain like
DictyBaseDDB_G02863032.0006821221283624e-88ku80 on chromosome: 4 position
4329334 to 4331844
Stentor CoeruleusSteCoe_287605.0345753587649823e-45
SGDYMR106C0.00000000030007160092483236YKU80 Subunit of the telomeric
Ku complex (Yku70p-Yku80p), i
nvolved in telomere length mai
ntenance, structure and telome
re position effect; relocates
to sites of double-strand clea
vage to promote nonhomologous
end joining during DSB repair

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000185
  2. Ref:SUPR000167

Sequences

>TTHERM_00492460(coding)
ATGGCAGGAAAAGAAGCTACTATTATCCTATTAGATATGGGTAGTTCTATGCAATAGTAT
TTAGGTGATAGAGGAACTAATGGTTAAAAAAGAATCGAAATAGCCGTTAATTGCATAAAA
CTCTTATTATAACAAAAAATGTTTAATACAAAGACTCATGAAGTTGGACTTATTTTATTT
GGTCTTAAAGATGAAGGTGACGATAAAATTATGTATATCAGAGGTATAGGAAAGCCTGAT
ATTGACTTTTTAAAGAATGTTCAAGATTTGAAAGATTATTAATCTGATGAATGCGAAGGA
GGAGATATTTTTGAAGCTATTGAGCAAACAATAGATGTTATTCATGATTACGTTAAAGAA
AAAAAATATGAAAAGAAAATTCAATTGATGACAGCAGGATTTGGAAAAACCAGCTACAAG
GAAAAATAAATAATGGATTTAATTGAAAAGGCCAGAAAGGTTCAAACTAAAATTAATGTT
ATTGGTTTTGACTTCTTAAAGAAATATAATCCTGAAGAAAGCAATACTGATGTGTTGAAA
AAAGACGATGCTGCATAAAATACCAGATAAAATTTAAATTAAAAGCTATTCTCAGTTGTT
AAAGATGAATTAGGTGAACAAATTCAACTTTTCCCTTCAGATGTTGCTATTAAAATTTAT
GAGCAGTTTAGAACTCGTCAAGTTAATCTTAGATCAAAGTTTAATGGTGATTTGTAGCTT
GCTCCTAATCTCAATATAGCAGTGCAAATGTTCACAAAAACTTCAGAGGAAAAACTCCCT
GGCTTAAAAATGTATTCATTAGCTGTTGACTTTAATCCTCATTGTGAAAGCGGATAAATC
GAGCGTGATGTAATAATGGCACTTTAAGAAGATCCAAACTTGAATCCTATTGATAAATCT
AACATAACTAAGGCATATCATTATGGAAAATAACTCATTCCTGTTACTTAAGCTTTGGAG
GCTTAAATGAATTATACTTCAAATCGTGAATTGAAGGTTTTAGGTTTTGTAGATTCCAAA
AAAGTTCCAAGATAGTCCTTTATGGCTGGTGTAGATATTATTATTGCTAATAAAAATGAT
TCTGTTGCTAAAAAAGGTATTGCTGCTCTTTGTCATAGTATGATCTAAACCAATAAATAT
GCTATAGCCCGTTATGTATGGCGTAATAATGGTGCTCCCAAGCTTTGCGTTTTGACTCCA
TAAATTGGTAAAGACTATGAATGCCTTTACATGTGCTAAATTCCTACTTCTGAAAGTGTC
CGCGATTTTTAGTTTAATTCTCTCAAAGAAAGCACAAAAGAATAACAAGATTTAATGGGA
TCTCTTATAGACAAAATGGATTTAATGAATCTTGAAGATGGCGAAGAAGCATTATAGATG
AAATACACTTTTAATCCTACCCGTTAATACTTTTATTAAACTGTTTTCCATCGAGTATTT
AATCCTCCCGATGCTGATACTAAAATTCCTCCACTTGATCCTAATATCAGAGACTATATA
ACTCCTGAAAAGAAGGTTTACCCCAAAGCTGCAGAAGAGTTAAAGAAAATAAAAGAGTCT
TTCTAACTTTAAGAGCAAGAAATTAAAGACGAAATTTCAAAGAAAATTTTTTGGTAATAA
CTCTTTAATCCTAACTATCAAGTACCTGCTGCAAATATTAATGCTCCTCAAGTCTAAATT
AAGATGGAAAACGGCTAGATGGAGTCAGAAGATGTAGAACAGTAAGCTTAAATTCTTGTA
GATGTAAAAGAAGAATTAGAAAATATTCCTATCTCAAAGAAATTTGCTTTCGACGATTAT
AACAAAGACGATGTAGTACGCAAGGTTTCATCAGTATCGCCTGTTGATGATTTCTTCAAG
ATGATGACAAACAAGCGCGAAGATCTCGTTTCTGATGCTATATCACAAATATAAGGTATG
ATATCTCAGTTAATAGAAACAAGTATCCGTGGCTCTTATTATGAAAAAGCTCTTGAATGT
ATCAAAGCATTTAGAAAAGGTTGTACTTCAGAATACGAACAGTTAGAAGCACCCAAATTT
AATAATTTCCTTAATACTTTCAAAGACAAGTTGTTAAAGTCAGATTAAAAAGGATTTTGG
AAAATGCTCATATAATAAGGTATAACTCTAATTACAGATAAAGAAAGCACAAAATCTAAT
TTTACCACTAAAGAAGCTCTCTAGTTTTTGCACTAAGAAGAAGATGTCATTTAAAATATA
CCTGAAGTAAGAAAATAAATCGAAGATTATGATATCATGGACGAACTAGAATGA


>TTHERM_00492460(protein)
MAGKEATIILLDMGSSMQQYLGDRGTNGQKRIEIAVNCIKLLLQQKMFNTKTHEVGLILF
GLKDEGDDKIMYIRGIGKPDIDFLKNVQDLKDYQSDECEGGDIFEAIEQTIDVIHDYVKE
KKYEKKIQLMTAGFGKTSYKEKQIMDLIEKARKVQTKINVIGFDFLKKYNPEESNTDVLK
KDDAAQNTRQNLNQKLFSVVKDELGEQIQLFPSDVAIKIYEQFRTRQVNLRSKFNGDLQL
APNLNIAVQMFTKTSEEKLPGLKMYSLAVDFNPHCESGQIERDVIMALQEDPNLNPIDKS
NITKAYHYGKQLIPVTQALEAQMNYTSNRELKVLGFVDSKKVPRQSFMAGVDIIIANKND
SVAKKGIAALCHSMIQTNKYAIARYVWRNNGAPKLCVLTPQIGKDYECLYMCQIPTSESV
RDFQFNSLKESTKEQQDLMGSLIDKMDLMNLEDGEEALQMKYTFNPTRQYFYQTVFHRVF
NPPDADTKIPPLDPNIRDYITPEKKVYPKAAEELKKIKESFQLQEQEIKDEISKKIFWQQ
LFNPNYQVPAANINAPQVQIKMENGQMESEDVEQQAQILVDVKEELENIPISKKFAFDDY
NKDDVVRKVSSVSPVDDFFKMMTNKREDLVSDAISQIQGMISQLIETSIRGSYYEKALEC
IKAFRKGCTSEYEQLEAPKFNNFLNTFKDKLLKSDQKGFWKMLIQQGITLITDKESTKSN
FTTKEALQFLHQEEDVIQNIPEVRKQIEDYDIMDELE


>TTHERM_00492460(gene)
ATGGCAGGAAAAGAAGCTACTATTATCCTATTAGATATGGGTAGTTCTATGCAATAGTAT
TTAGGTGATAGAGGAACTAATGGTTAAAAAAGAATCGAAATAGCCGTTAATTGCATAAAA
CTCTTATTATAACAAAAAATGTTTAATACAAAGACTCATGAAGTTGGACTTATTTTATTT
GGTCTTAAAGATGAAGGTGACGATAAAATTATGTATATCAGAGGTATAGGAAAGCCTGAT
ATTGACTTTTTAAAGAATGTTCAAGATTTGAAAGATTATTAATCTGATGAATGCGAAGGA
GGAGATATTTTTGAAGCTATTGAGCAAACAATAGATGTTATTCATGATTACGTTAAAGAA
AAAAAATATGAAAAGAAAATTCAATTGATGACAGCAGGATTTGGAAAAACCAGCTACAAG
GAAAAATAAATAATGGATTTAATTGAAAAGGCCAGAAAGGTATTTTATTTCATTCATGTT
TTGCAAAAAAAAATATTTTTGCTATCACAATCGCATATTGAAGAGCATCTATCTATTTAA
CTATCATAATTTGAATTTTTTCCCCTTCATTAGAAGCTCTATCCAAACCTCCCCCTTTAG
AATTAACTATAATTTTACTCTGATCTTTTTTTTTTTCAAAATTAATAAATTAGCATTTTA
AAAGTTTTAAAGTATATTAAACACATTTTTTTTAATTTTTCTAGGAGGGCAAGATTTATT
TTTAATTAAGTGTATTAATTGTTTCAAAATATCATTTTTTCATATCAAAAAATTTCAAAA
AATAATTATTTATTTTTCATTTATTTAATAATAGAAATATTCAAAAATTTAATATATTTT
TAAATATTTAAACAGGTTCAAACTAAAATTAATGTTATTGGTTTTGACTTCTTAAAGAAA
TATAATCCTGAAGAAAGCAATACTGATGTGTTGAAAAAAGACGATGCTGCATAAAATACC
AGATAAAATTTAAATTAAAAGCTATTCTCAGTTGTTAAAGATGAATTAGGTGAACAAATT
CAACTTTTCCCTTCAGATGTTGCTATTAAAATTTATGAGCAGTTTAGAACTCGTCAAGTT
AATCTTAGATCAAAGTTTAATGGTGATTTGTAGCTTGCTCCTAATCTCAATATAGCAGTG
CAAATGTTCACAAAAACTTCAGAGGAAAAACTCCCTGGCTTAAAAATGTATTCATTAGCT
GTTGACTTTAATCCTCATTGTGAAAGCGGATAAATCGAGCGTGATGTAATAATGGCACTT
TAAGAAGATCCAAACTTGAATCCTATTGATAAATCTAACATAACTAAGGCATATCATTAT
GGAAAATAACTCATTCCTGTTACTTAAGCTTTGGAGGCTTAAATGAATTATACTTCAAAT
CGTGAATTGAAGGTTTTAGGTTTTGTAGATTCCAAAAAAGTTCCAAGATAGTCCTTTATG
GCTGGTGTAGATATTATTATTGCTAATAAAAATGATTCTGTTGCTAAAAAAGGTATTGCT
GCTCTTTGTCATAGTATGATCTAAACCAATAAATATGCTATAGCCCGTTATGTATGGCGT
AATAATGGTGCTCCCAAGCTTTGCGTTTTGACTCCATAAATTGGTAAAGACTATGAATGC
CTTTACATGTGCTAAATTCCTACTTCTGAAAGTGTCCGCGATTTTTAGTTTAATTCTCTC
AAAGAAAGCACAAAAGAATAACAAGATTTAATGGGATCTCTTATAGACAAAATGGATTTA
ATGAATCTTGAAGATGGCGAAGAAGCATTATAGATGAAATACACTTTTAATCCTACCCGT
TAATACTTTTATTAAACTGTTTTCCATCGAGTATTTAATCCTCCCGATGCTGATACTAAA
ATTCCTCCACTTGATCCTAATATCAGAGACTATATAACTCCTGAAAAGAAGGTTTACCCC
AAAGCTGCAGAAGAGTTAAAGAAAATAAAAGAGTCTTTCTAACTTTAAGAGCAAGAAATT
AAAGACGAAATTTCAAAGAAAATTTTTTGGTAATAACTCTTTAATCCTAACTATCAAGTA
CCTGCTGCAAATATTAATGCTCCTCAAGTCTAAATTAAGATGGAAAACGGCTAGATGGAG
TCAGAAGATGTAGAACAGTAAGCTTAAATTCTTGTAGATGTAAAAGAAGAATTAGAAAAT
ATTCCTATCTCAAAGAAATTTGCTTTCGACGATTATAACAAAGACGATGTAGTACGCAAG
GTTTCATCAGTATCGCCTGTTGATGATTTCTTCAAGATGATGACAAACAAGCGCGAAGAT
CTCGTTTCTGATGCTATATCACAAATATAAGGTATGATATCTCAGTTAATAGAAACAAGT
ATCCGTGGCTCTTATTATGAAAAAGCTCTTGAATGTATCAAAGCATTTAGAAAAGGTTGT
ACTTCAGAATACGAACAGTTAGAAGCACCCAAATTTAATAATTTCCTTAATACTTTCAAA
GACAAGTTGTTAAAGTCAGATTAAAAAGGATTTTGGAAAATGCTCATATAATAAGGTATA
ACTCTAATTACAGATAAAGAAAGCACAAAATCTAATTTTACCACTAAAGAAGCTCTCTAG
GTAAACAATATTTTAATTACTTTTAACCAGTTTTGGAATTCGCTCAATATTAATCACACA
TTTAATTATAAAGTTAAATTGTAAATTTGCTTATTTTTTAATTATTATTTAATATTAAAA
GTTTTTGCACTAAGAAGAAGATGTCATTTAAAATATACCTGAAGTAAGAAAATAAATCGA
AGATTATGATATCATGGACGAACTAGAATGA