Identifiers and Description

Gene Model Identifier

TTHERM_00561799

Standard Name

TKU70 (DNA-dependent ATP-dependent helicase)

Aliases

3720.m00655

Description

homolog to human KU70 DNA helicase and yeast YKU70

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

  • double-strand break repair via nonhomologous end joining (IEA) | GO:0006303

Domains

  • ( PF02037 ) SAP domain
  • ( TIGR02772 ) Ku protein
  • ( PF03730 ) Ku70/Ku80 C-terminal arm
  • ( PF02735 ) Ku70/Ku80 beta-barrel domain
  • ( PF00092 ) von Willebrand factor type A
  • ( PF03731 ) Ku70/Ku80 N-terminal alpha/beta domain
  • ( TIGR00578 ) ATP-dependent DNA helicase ii, 70

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00561799

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16104.19.997093137033517e-262ku P70 DNA helicase (716 aa)
OxytrichaContig17155.0.g655.998305401373361e-129Ku70/Ku80 beta-barrel domain
DictyBaseDDB_G02860693.0000115468388957e-66ku70 on chromosome: 4 position
4023180 to 4025992
Stentor CoeruleusSteCoe_12931.6889118802245324e-48
SGDYMR284W0.000000030002053728821195YKU70 Subunit of the telomeric
Ku complex (Yku70p-Yku80p), i
nvolved in telomere length mai
ntenance, structure and telome
re position effect; relocates
to sites of double-strand clea
vage to promote nonhomologous
end joining during DSB repair

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00561799(protein)
MEFDEFEDDFVGGDAGEGGDQAQGFDFQENEFIPDLISKKDAVIFLIDCNKKIFQNEFND
EVQFKVILKSIQSFFKSKIISSLDDQVSVIFYNVKQTNNDLNFKGINIVYNLSTPSAEMI
KNVVKLGDNFERDFGFADNETPFHEALWTCNSIFTKLDSKKFIMRIFLFTNNDQPHSDNK
DFLDKCFNQARTLAEKNIQIELFPLATRNQKFDIRKFYSSIITFDVDEINEAVIDTSDKV
LDIQHRLRQKEYKKRAVNRLLFTLGDETRLGVKLFCPFVKQRRPLAKQLESNTNKLLKRT
VKHICKETGQSLYQNQISTCVHIGGEKVKVSKGDINEIKSFEEPGMRLIGFKPSGTLKAY
HNYRTSYFVYPDDYHVKGSSQSFHALISQMIAKDKIAIVRFIPRKGTQVRFCALLPQEES
YDEDHVQTPPGFHLIFLPYADDQRNLGSIRPQQKEEVSRNLLNAAKMMCNALDLANFDFR
NFEDPSLQKFFAHLQAHALQEENPENPADLIQPDEEGMKRCEDIIKLFEEALKLDVQDDD
QPQAAQKKPRQKKVAVEKQPAAQKKQPAPKKPAQNKKQVKKEEESEASSIGDYDSEDSFI
DNEEDEIKPKKRGVQNKKVTNQRKVNKKVEYSDEDDEISYEEKPKRKAAGKKQMSEEEKL
ISHVEANLKEEFNPDGLTISELKQYLKFKGLKNVGKKEELVDTILRHLERN


>TTHERM_00561799(coding)
ATGGAATTTGATGAATTTGAAGATGACTTCGTCGGCGGAGACGCTGGAGAAGGTGGTGAC
CAAGCTTAGGGATTTGATTTCTAGGAAAACGAATTTATTCCTGATCTCATAAGTAAAAAA
GATGCAGTCATCTTTTTAATTGACTGCAACAAGAAGATCTTCCAAAACGAGTTTAATGAT
GAAGTTTAGTTTAAAGTAATACTAAAGAGTATTTAGAGTTTCTTCAAGTCAAAGATTATT
TCAAGTTTAGATGACTAAGTTTCTGTTATTTTCTACAATGTGAAACAAACAAATAATGAT
TTGAACTTTAAGGGGATCAATATAGTTTATAATCTTAGCACTCCTTCAGCAGAAATGATT
AAAAACGTAGTTAAGTTAGGAGATAATTTTGAAAGAGATTTCGGTTTTGCAGACAATGAA
ACACCTTTCCACGAAGCATTGTGGACTTGCAATAGCATTTTTACAAAATTAGATAGTAAA
AAATTTATAATGAGAATATTCCTATTCACCAACAATGATTAGCCCCATTCAGATAATAAA
GATTTTTTAGATAAGTGCTTTAACTAAGCAAGAACTTTGGCAGAAAAGAATATCTAAATT
GAGTTGTTCCCTCTTGCTACTAGAAACTAAAAGTTTGATATCAGAAAATTCTATTCAAGC
ATCATTACCTTTGATGTAGATGAAATTAATGAAGCTGTTATCGATACATCAGATAAAGTT
TTGGATATCCAACACAGATTACGTCAAAAAGAATACAAAAAAAGGGCAGTCAACAGATTA
CTTTTTACTTTGGGTGATGAAACTAGATTGGGAGTCAAATTGTTTTGCCCATTCGTGAAA
TAAAGACGCCCTCTTGCCAAATAATTAGAATCTAACACTAATAAACTTTTAAAAAGGACA
GTAAAGCATATTTGCAAAGAAACAGGTTAGTCTTTATATCAAAACCAAATTTCCACATGT
GTTCACATTGGAGGAGAGAAGGTTAAAGTTAGTAAAGGTGATATTAATGAAATCAAATCA
TTCGAAGAACCAGGTATGCGTTTAATAGGATTTAAACCTTCAGGAACACTTAAGGCTTAC
CACAACTATAGAACAAGCTACTTTGTTTACCCAGATGATTATCATGTAAAGGGATCATCT
CAATCTTTTCATGCTTTGATCTCATAAATGATTGCCAAAGATAAAATAGCTATTGTTAGA
TTCATTCCCCGTAAAGGCACTTAGGTTAGGTTCTGTGCTTTACTTCCATAAGAAGAAAGT
TATGATGAAGACCATGTTTAAACACCTCCAGGCTTTCATTTGATTTTCTTACCATATGCT
GATGATTAGAGAAATTTAGGTTCCATCAGACCTTAATAAAAGGAAGAAGTTAGCAGAAAT
TTACTAAATGCAGCTAAAATGATGTGCAATGCATTAGATTTAGCTAATTTTGATTTTAGA
AATTTCGAAGATCCTTCACTATAGAAATTTTTTGCTCATCTTCAGGCACATGCCTTATAA
GAAGAAAACCCAGAAAATCCAGCAGACTTGATCTAACCTGATGAAGAAGGTATGAAACGC
TGTGAAGATATAATTAAGCTATTTGAAGAAGCATTGAAGTTAGATGTATAAGATGATGAC
CAACCTCAAGCCGCTTAAAAAAAACCAAGATAAAAAAAGGTAGCTGTTGAAAAGTAACCT
GCTGCACAAAAGAAATAACCTGCTCCAAAAAAGCCTGCTTAAAACAAAAAATAAGTAAAA
AAAGAAGAAGAGTCTGAAGCAAGCAGTATAGGTGATTATGACTCTGAGGACTCCTTTATC
GATAATGAAGAAGATGAAATTAAGCCTAAAAAAAGAGGAGTTTAAAACAAAAAAGTGACT
AATTAAAGAAAAGTTAATAAAAAAGTTGAATACAGTGATGAAGATGATGAGATAAGCTAT
GAAGAAAAACCAAAACGAAAAGCAGCAGGGAAGAAACAAATGAGCGAAGAAGAAAAACTT
ATTTCACATGTAGAAGCTAATTTAAAAGAAGAATTCAACCCAGATGGTTTGACAATATCT
GAGCTTAAATAGTATCTTAAGTTCAAAGGACTTAAAAATGTTGGTAAAAAGGAAGAATTG
GTTGATACCATTTTAAGACACTTAGAAAGAAATTGA


>TTHERM_00561799(gene)
ATGGAATTTGATGAATTTGAAGATGACTTCGTCGGCGGAGACGCTGGAGAAGGTGGTGAC
CAAGCTTAGGGATTTGATTTCTAGGAAAACGAAGTACTTTAAAAATTATTTGCTATTTTT
TTAGTAAGAAACACAATAACATAAAAAATAAAAAGTTTATTCCTGATCTCATAAGTAAAA
AAGATGCAGTCATCTTTTTAATTGACTGCAACAAGAAGATCTTCCAAAACGAGTTTAATG
ATGAAGTAAAACTATTTTTGAAAAGTTTTGATTTTAATTGTGTTTTAAATATTTGTTTAT
TGCAGGTTTAGTTTAAAGTAATACTAAAGAGTATTTAGAGTTTCTTCAAGTCAAAGATTA
TTTCAAGTTTAGATGACTAAGTTTCTGTTATTTTCTACAATGTGGTATGATATTTCATTT
GAAAAGACTTTCAATTTTAAGGTTTATTACAAAAAATCAATCAAAGAAACAAACAAATAA
TGATTTGAACTTTAAGGGGATCAATATAGTTTATAATCTTAGCACTCCTTCAGCAGAAAT
GATTAAAAACGTAGTTAAGTTAGGTAATCTAATTGTAGGTTTTATAAAGTAATTCATATT
ACTTACATTATAATAGGAGATAATTTTGAAAGAGATTTCGGTTTTGCAGACAATGAAACA
CCTTTCCACGAAGCATTGTGGACTTGCAATAGCATTTTTACAAAATTGTAAATAATAATA
TTTAATTAAAAAATATTTGTATCTCAAGCATTTATTTATTAATTACAGAGATAGTAAAAA
ATTTATAATGAGAATATTCCTATTCACCAACAATGATTAGCCCCATTCAGATAATAAAGA
TTTTTTAGATAAGTGCTTTAACTAAGCAAGAACTTTGGCAGAAAAGAATATCTAAATTGA
GTTGTTCCCTCTTGCTACTAGAAACTAAAAGTTTGATATCAGAAAATTCTATTCAAGCAT
CATTACCTTTGATGTAGATGAAATTAATGAAGCTGTTATCGATACATCAGATAAAGTTTT
GGATATCCAACACAGATTACGTCAAAAAGAATACAAAAAAAGGTATTAATTCATATACAT
TTTTTAATTGCTAATGAATATATTTAATAGTCAGAATAATATTTAAATGATTTAAGTAAA
TAAAGTAAATAATATGATTCTAATTAATATATTTCAACTTTTATCAAATATTCACTTATC
TTGTATCAAGCAATGAATCATTAATAGCTATAAAATTATAGATTTTAATTTATTAAAACT
AAAAAGAAAGTCAATAAATTAAATGCATGTACCATGAATAACTAACTATATAATTATGGA
TTTTAATTTATTTAAACTACAACGAAAGTGAATTAATTAAATACATGCATCATGGCTGGC
TGGATATAAAATTATGGATTTCAATTTATAAAAATTTTAAAGAAAGTAAATTAATTAAAT
AATAAATAAATAAAAAAAAGGGCAGTCAACAGATTACTTTTTACTTTGGGTGATGAAACT
AGATTGGGAGTCAAATTGTTTTGCCCATTCGTGAAATAAAGACGCCCTCTTGCCAAATAA
TTAGAATCTAACACTAATAAACTTTTAAAAAGGACAGTAAAGCATATTTGCAAAGAAACA
GGTTAGTCTTTATATCAAAACCAAATTTCCACATGTGTTCACATTGGAGGAGAGAAGGTT
AAAGTTAGTAAAGGTGATATTAATGAAATCAAATCATTCGAAGAACCAGGTATGCGTTTA
ATAGGATTTAAACCTTCAGGAACACTTAAGGCTTACCACAACTATAGAACAAGCTACTTT
GTTTACCCAGATGATTATCATGTAAAGGGATCATCTCAATCTTTTCATGCTTTGATCTCA
TAAATGATTGCCAAAGATAAAATAGCTATTGTTAGATTCATTCCCCGTAAAGGCACTTAG
GTTAGGTTCTGTGCTTTACTTCCATAAGAAGAAAGTTATGATGAAGACCATGTTTAAACA
CCTCCAGGCTTTCGTAAGATTTTTTTTTTCTATGTATTTATTTAATGAATTTAAACTTAT
TAGATTTGATTTTCTTACCATATGCTGATGATTAGAGAAATTTAGGTTCCATCAGACCTT
AATAAAAGGAAGAAGTTAGCAGAAATTTACTAAATGCAGCTAAAATGATGTGCAATGCAT
TAGATTTAGCTAATTTTGATTTTAGAAATTTCGAAGATCCTTCACTATAGAAATTTTTTG
CTCATCTTCAGGCACATGCCTTATAAGAAGAAAACCCAGAAAATCCAGCAGACTTGATCT
AACCTGATGAAGAAGGTATGAAACGCTGTGAAGATATAATTAAGCTATTTGAAGAAGCAT
TGAAGTTAGATGTATAAGATGATGACCAACCTCAAGCCGCTTAAAAAAAACCAAGATAAA
AAAAGGTAGCTGTTGAAAAGTAACCTGCTGCACAAAAGAAAGTAAATCTTACTTAATTAA
TATCAAAATAATGAAAAAGTTTAAAATAATTTTAATTAAAATACGAAAAGTAACCTGCTC
CAAAAAAGCCTGCTTAAAACAAAAAATAAGTAAAAAAAGAAGAAGAGTCTGAAGCAAGCA
GTATAGGTGATTATGACTCTGAGGACTCCTTTATCGATAATGAAGAAGATGAAATTAAGC
CTAAAAAAAGAGGAGTTTAAAACAAAAAAGTGACTAATTAAAGAAAAGTTAATAAAAAAG
TTGAATACAGTGATGAAGATGATGAGATAAGCTATGAAGAAAAACCAAAACGAAAAGCAG
CAGGGAAGAAACAAATGAGCGAAGAAGAAAAACTTATTTCACATGTAGAAGCTAATTTAA
AAGAAGAATTCAACCCAGATGGTTTGACAATATCTGAGCTTAAATAGTATCTTAAGTTCA
AAGGACTTAAAAATGTTGGTAAAAAGGAAGAATTGGTTGATACCATTTTAAGACACTTAG
AAAGAAATTGA