Identifiers and Description

Gene Model Identifier

TTHERM_00112550

Standard Name

TKT1 (TransKeTolase)

Aliases

PreTt27069 | 8.m00329 | 3812.m02366

Description

Transketolase; catalyzes conversion of xylulose-5-phosphate and ribose-5-phosphate to sedoheptulose-7-phosphate and glyceraldehyde-3-phosphate in the pentose phosphate pathway; needed for synthesis of aromatic amino acids

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00112550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_54050
WormBaseWBGene000085069.997093137033517e-262locus:tkt-1 status:Confirmed
UniProt:O17759 protein_id
:CAB02889.1
Tetrahymena borealisEI9_03959.19.997093137033517e-262transketolase, pyridine bindin
g domain-containing protein (6
52 aa)
SGDYPR074C9.000270655364168e-50TKL1 Transketolase, similar to
Tkl2p; catalyzes conversion o
f xylulose-5-phosphate and rib
ose-5-phosphate to sedoheptulo
se-7-phosphate and glyceraldeh
yde-3-phosphate in the pentose
phosphate pathway; needed for
synthesis of aromatic amino a
cids
DictyBaseDDB_G02726183.9990760533890984e-36tkt-1 on chromosome: 2 positio
n 2357975 to 2360086
OxytrichaContig9079.0.0.g830.0004000184047659232Dehydrogenase E1 component

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00112550(coding)
ATGAATACAAGAAGCGGCAAAAAATCTAGTGCCTCCAACTCCAAGCCCGAAACCACCACT
TCTACCACTAAGAATTCTACCAATAAGAAGGTTAAGGCCAACGAAGAACATGACATCGAA
GCTCTTCAAGACGTTGCTAACAGATTGAGAATTCTTTCCATGAAGATGACCAACGCCTCT
AATAGTGGTCACCCTACCAGTTGTGCATCTATGGCTGAATTCCTTTCAGTTATGTTCTTC
GACAAGTCTGGTATGAGAATCAAGAGTGATAACCCCAAGTCATTTGTTGCTGACAGATTA
GTTTTATCTAAGGGCCACACTGCCCCTATTTTGTATGCTGCATGGGGAATTGCAGGCTTA
TACACTGAAGAATAATTAATGACCCTCCGTAAATTCGACTCTGATTTAGAAGGTCACCCT
ACTCCTAGACTTCCCTTCGTCGATGTTGCTACTGGTTCTTTGGGTCAAGGTTTAGGTGTT
GCTTGCGGTATGGCTTATACTTCTAAATACCACGACAGCCTTAACAACCGTTTCTGGTGT
ATCCTCGGTGATGGTGAATGCGCTGAAGGTTCTGTTTGGGAAGCTGCTCACTTTGCTGGT
ATTTACAAGTTAGATAACTTGATTGCTGTCGTTGATGTCAACAGATTAGGTTAATCTGAA
GCTACCTCTTTGGGTCATAATACTAACGTTTATAAGAAGAGATTCGAAGCCTTTGGCTGG
AATGCTTTGGTTGTTGATGGACACGATATTGAAGCCCTCATTAAGGCTTTCAATGAATGC
AAGCACAAGGCTAACTAACCCAGTATCATTATTGCTAAGACCTTAAAAGGAAAGGGTCTT
CCTAATATTGAAGACTAAGAAAACTGGCACGGTAAGCCCGTCGGCAACAAGATTGACGAT
TTGATCAAGCACCTTGAAGAATAGCTTGTCGATAAGAACAGAAAGCTTACTACCATCCCC
CCTGAGAATGCTGAAGAAATTACTCTTCATTCAGATGCAATTAAATTACCCGAACTTAGC
TACAAGAAAGGACAACAAGTTGCTACCAGATTCGCTTATGGTGATGCCTTGAAGAGACTC
GGTGGTGTTGACACTTACAGAAGAATTTGCTCTTTGGATGGTGATACCAAGAACTCTACT
TATGCCCTTACTTTCAAGAACGCATTCCCTGACAGATTTGTTGAATGCTACATTGCTGAA
TAAAACTTAGTCTCTGTTTCTATTGGTTTATCTGCCAGAAACAAGATTCCTTTTGCCTCC
ACTTTTGGTGCTTTCTTCTCTAGAGCTTACGATCACATTAGAATGGCTGGTGTTTCTAAG
GTTAACATTAAATTAGTAGGTTCTCACTCTGGTGTTTCTATTGGTGAAGATGGTCCTTCA
TAAATGGCTTTGGAAGACTTTGCCATGTTCAGAGCTATTCCTGATGCTGTCGTCCTCTAT
CCTTCTGATGCTGTTTCTTGTGAAAGAGCTGTTGAATTAGCTACTAATCATCACGGTATC
GTATACATCCGTACTTCAAGACCTGCTACTGAAGTAGTTTATGATAACCATGAAGAATTC
CATCTCGGTTAGTCTAAGGTACATGGTAAGACTGATTCTGATAAGATTCTTATTATTGGT
GGTGGTATTACATTCGAATCTGCCATGAAGGCTCAAAAAACTTTGGCTGCTGAAGGAATC
CACGCTAGAGTTATGGATATCTTTTCTATTAAACCTATTGATAGAGATGGTATCATCAAC
AATGCTAAAGAATGCAATAATACTATCCTCACTGTTGAAGATCACTACATCGAAGGTGGT
ATCCATGAGGCTGTTTGCAATGCTGTTGCTTCTCTCGGTAGCATCAAGGTTCACGCTATT
GCCGTCGATAGCGTTCCTAGAAGTGGTACTCCTGAAGATCTCTTAAATCATTATAAACTT
ACTGCTCCTCACGTAGTTGAAAAGGTTAAGAGCATCCTTCAATGA


>TTHERM_00112550(protein)
MNTRSGKKSSASNSKPETTTSTTKNSTNKKVKANEEHDIEALQDVANRLRILSMKMTNAS
NSGHPTSCASMAEFLSVMFFDKSGMRIKSDNPKSFVADRLVLSKGHTAPILYAAWGIAGL
YTEEQLMTLRKFDSDLEGHPTPRLPFVDVATGSLGQGLGVACGMAYTSKYHDSLNNRFWC
ILGDGECAEGSVWEAAHFAGIYKLDNLIAVVDVNRLGQSEATSLGHNTNVYKKRFEAFGW
NALVVDGHDIEALIKAFNECKHKANQPSIIIAKTLKGKGLPNIEDQENWHGKPVGNKIDD
LIKHLEEQLVDKNRKLTTIPPENAEEITLHSDAIKLPELSYKKGQQVATRFAYGDALKRL
GGVDTYRRICSLDGDTKNSTYALTFKNAFPDRFVECYIAEQNLVSVSIGLSARNKIPFAS
TFGAFFSRAYDHIRMAGVSKVNIKLVGSHSGVSIGEDGPSQMALEDFAMFRAIPDAVVLY
PSDAVSCERAVELATNHHGIVYIRTSRPATEVVYDNHEEFHLGQSKVHGKTDSDKILIIG
GGITFESAMKAQKTLAAEGIHARVMDIFSIKPIDRDGIINNAKECNNTILTVEDHYIEGG
IHEAVCNAVASLGSIKVHAIAVDSVPRSGTPEDLLNHYKLTAPHVVEKVKSILQ


>TTHERM_00112550(gene)
ATGAATACAAGAAGCGGCAAAAAATCTAGTGCCTCCAACTCCAAGCCCGAAACCACCACT
TCTACCACTAAGAATTCTACCAATAAGAAGGTTAAGGCCAACGAAGAACATGACATCGAA
GCTCTTCAAGACGTTGCTAACAGATTGAGAATTCTTTCCATGAAGATGACCAACGCCTCT
AATAGTGGTCACCCTACCAGTTGTGCATCTATGGCTGAATTCCTTTCAGTTATGTTCTTC
GACAAGTCTGGTAAGCTTAAAACCCAAAGCATTAACTTTACGGCTATATCTTCTTACAGT
TTATTAAAGAAAAATGTTATTAATTGACATTCAGAAACTCTTTTTAACCTAAATTTAAAC
TTAATAGCCATCTGATTTTTATTTTAAATTTTTTATATGAATTTATAAAAATGAAGATAA
ATGATGTATTTATACTTCGTAACTTCATTTAATAAATCATTTCTAAATGGAGAAATGTGT
TTAATCAATTTTTTGTTCATAATTTAGGTATGAGAATCAAGAGTGATAACCCCAAGTCAT
TTGTTGCTGACAGATTAGTTTTATCTAAGGGCCACACTGCCCCTATTTTGTATGCTGCAT
GGGGAATTGCAGGCTTATACACTGAAGAATAATTAATGACCCTCCGTAAATTCGACTCTG
ATTTAGAAGGTCACCCTACTCCTAGACTTCCCTTCGTCGATGTTGCTACTGGTTCTTTGG
GTCAAGGTTTAGGTGTTGCTTGCGGTATGGCTTATACTTCTAAATACCACGACAGCCTTA
ACAACCGTTTCTGGTGTATCCTCGGTGATGGTGAATGCGCTGAAGGTAATTTTATACTTT
TAATTCAGATTTTTAGAGGTTAAAAATAATATTTATGAAATCCATTTCATATCATATTCC
ATTGAATAAAATCTACTTATTATTTGCAGAGATAACTTGTTTTAATTTCAAGTGTCTAGA
CTTTGTTTCTACTGCATAGGAAGATATCTTCTTTAAAAGCATTTTCAAAGAGAAAAATCT
ATAATAAATTTATTATCTTTGTGTATAGACTGCGATTTGGTATGACAGATAACAAAAAAT
TTGAAATAGAGTGTAAAAAAGCACAAAAATACAAAAAAATGAAAAAATATCTTTCGCATT
TTACTAACTCTACTTTGTAAATTTATTAATAGAACAAATTAAGGATTTTTTATTATTTTT
AGATTTTATTTGAAAAAAATTGATAGTTATTTTGAGAGATATCTATTTATCTATCAATCT
ATCTATTTAGCTAATAAGCTAATATCTATTTGCTTGCTTTAAAATGATCAATTCAAGCTT
TTATACACTTGATAGAACTTTTGTCTATTTAATATATCAAAATTAATGATTTTCATTCAA
AGATATATTTGTTTAGTTTTAAAAAGAGCATAAAATTATGGAATCGAAGCAAACAAATAA
ATGTTAATTACGATTTACTCATTTTTTCTTAATTGGAATACTTTAAAAGAAATCAAAAGA
AGCACACACACAATCAGAAAATAAAAGTCTATTTTTTAATTTGCTTTAATAAGAAATGTA
AATAATACAAGCTTTACATAGAATTGAATGATAATTAGTTCAAGTTAAGCTTTTCTAGAA
ATTTTAATCAGTAAACACCGCAAATCAAAAACTTTTTTCAATTTTATTAAAATAACCTCA
AATTAAATCTTAAAAATTGCATTAATTTAACTAACATCTTTTAATTACTAATATAGGTTC
TGTTTGGGAAGCTGCTCACTTTGCTGGTATTTACAAGTTAGATAACTTGATTGCTGTCGT
TGATGTCAACAGATTAGGTTAATCTGAAGCTACCTCTTTGGGTCATAATACTAACGTTTA
TAAGAAGAGATTCGAAGCCTTTGGCTGGAATGCTTTGGTTGTTGATGGACACGATATTGA
AGCCCTCATTAAGGCTTTCAATGAATGCAAGCACAAGGCTAACTAACCCAGTATCATTAT
TGCTAAGACCTTAAAAGGAAAGGGTCTTCCTAATATTGAAGACTAAGAAAACTGGCACGG
TAAGCCCGTCGGCAACAAGATTGACGATTTGATCAAGCACCTTGAAGAATAGCTTGTCGA
TAAGAACAGAAAGCTTACTACCATCCCCCCTGAGAATGCTGAAGAAATTACTCTTCATTC
AGATGCAATTAAATTACCCGAACTTAGCTACAAGAAAGGACAACAAGTACAAAAATAATT
TTAATTACAATATTTTCAATAAAATTTATTTTTCTTGGCTAACATCTTATTTAATTTTAA
TAAAAGGTTGCTACCAGATTCGCTTATGGTGATGCCTTGAAGAGACTCGGTGGTGTTGAC
ACTTACAGAAGAATTTGCTCTTTGGATGGTGATACCAAGAACTCTACTTATGCCCTTACT
TTCAAGAACGCATTCCCTGACAGATTTGTTGAATGCTACATTGCTGAATAAAACTTAGTC
TCTGTTTCTATTGGTTTATCTGCCAGAAACAAGGTAAAAAATATAATACAAATAAAATTA
GCAAAATAAAAAAGATTATTCCTACCTAGATTTTTAATAGCTTAATATAATCAGTTTTTA
ATAGAGCATAAATAAAATAAAATAATATAATATAAAGAATAGATTTTATTATAAAAATAT
ATATTTAGTTGATTAGAGCAATTATTAATAAGTTAAAGAAAGCCCATATTTATTTATTAG
TTAAAGAAAATAAGCAAGCAAAAGCAAATTTATAAAGGAATTTAAAAACCAAATTGCATT
AATTAGCTTCTAAAATTATTTTTTTAAATTTAATGAATTTATTTATTTATTTGTATGATA
GATTCCTTTTGCCTCCACTTTTGGTGCTTTCTTCTCTAGAGCTTACGATCACATTAGAAT
GGCTGGTGTTTCTAAGGTTAACATTAAATTAGTAGGTTCTCACTCTGGTGTTTCTATTGG
TGAAGATGGTCCTTCATAAATGGCTTTGGAAGACTTTGCCATGTTCAGAGCTATTCCTGA
TGCTGTCGTCCTCTATCCTTCTGATGCTGTTTCTTGTGAAAGAGCTGTTGAATTAGCTAC
TAATCATCACGGTATCGTATACATCCGTACTTCAAGACCTGCTACTGAAGTAGTTTATGA
TAACCATGAAGAATTCCATCTCGGTTAGTCTAAGGTACATGGTAAGACTGATTCTGATAA
GATTCTTATTATTGGTGGTGGTATTACATTCGAATCTGCCATGAAGGCTCAAAAAACTTT
GGCTGCTGAAGGAATCCACGCTAGAGTTATGGATATCTTTTCTATTAAACCTATTGATAG
AGATGGTATCATCAACAATGCTAAAGAATGCAATAATACTATCCTCACTGTTGAAGATCA
CTACATCGAAGGTGGTATCCATGGTAATAATATATTTTTTTTTAGAAATTAATTTTTATT
TAATTGAATTTCTTTAATTAATAACAGAGGCTGTTTGCAATGCTGTTGCTTCTCTCGGTA
GCATCAAGGTTCACGCTATTGCCGTCGATAGCGTTCCTAGAAGTGGTACTCCTGAAGATC
TCTTAAATCATTATAAACTTACTGCTCCTCACGTAGTTGAAAAGGTTAAGAGCATCCTTC
AATGA