Identifiers and Description

Gene Model Identifier

TTHERM_00823520

Standard Name

TKI1 (Tetrahymena Kazal-type proteinase Inhibitor )

Aliases

PreTt20426 | 141.m00083 | 3682.m00017

Description

Kazal-type proteinase inhibitor 1; transcription of TKI1 induced following exocytosis; may be cargo protein of dense core secretory granules

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00050 ) Kazal-type serine protease inhibitor domain
  • ( PF07648 ) Kazal-type serine protease inhibitor domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 81.5%

TetraMine Data

TTHERM_00823520

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18171.12.000704504372864e-47kazal-type serine protease inh
ibitor domain-containing prote
in (158 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:12456006: Haddad A, Bowman GR, Turkewitz AP (2002) New class of cargo protein in Tetrahymena thermophila dense core secretory granules. Eukaryotic cell 1(4):583-93

Sequences

>TTHERM_00823520(coding)
ATGTACAAATTACTTTTGACTTTCTTGTTTTGCTTAAGCTTAGTAGCATCTCTAGGCTTA
CAATGTGAAGATTTTGAAAGATAAGCTAAAGGATGCCCTGAAATTTACAGTCCTGTCTGT
GCTATTCAATAACAAACTGGAAACTTTAGTCAAGTTAAAAAAGATTATTCAAACAAATGT
GAAGCCTGCTCTTAGAGTGAAACTTAGTTCGTAGTTCCTGGAAATTGTGAAGAATACCCT
AAAGAGGCTGTATTCTGTAACCCAGCTTTAAAGAAAAATCATGGTTGCATTGAAATTTAC
TAGGCAGTTTGTGGTGTTATGTTTTCTAATGAAAACTTTATGTGCGATAGCAAATATTGT
GCAAAAACCTATGACAACTTTTGTTTCGCTTGTTAAGACAGTGTTGTTGGATATTATGTC
AAAGGCGAATGTCAATAAAATGACTTTGAAGATAATGAAAATTATTGA


>TTHERM_00823520(protein)
MYKLLLTFLFCLSLVASLGLQCEDFERQAKGCPEIYSPVCAIQQQTGNFSQVKKDYSNKC
EACSQSETQFVVPGNCEEYPKEAVFCNPALKKNHGCIEIYQAVCGVMFSNENFMCDSKYC
AKTYDNFCFACQDSVVGYYVKGECQQNDFEDNENY


>TTHERM_00823520(gene)
ATGTACAAATTACTTTTGACTTTCTTGTTTTGCTTAAGCTTAGTAGCATCTCTAGGCTTA
CAATGTGAAGATTTTGAAAGATAAGCTAAAGGATGCCCTGAAATTTACAGTCCTGTCTGT
GCTATTCAATAACAAACTGGAAACTTTAGTCAAGTTAAAAAAGATTATTCAAACAAATGT
GAAGCCTGCTCTTAGAGTGAAACTTAGTTCGTAGTTCCTGGAAATTGTGAAGAATACCCT
AAAGAGGCTGTATTCTGTAACCCAGCTTTAAAGAAAAATCATGGTTGCATTGAAATTTAC
TAGGCAGTTTGTGGTGTTATGTTTTCTAATGAAAACTTTATGTGCGATAGCAAATATTGT
GCAAAAACCTATGACAACTTTTGTTTCGCTTGTTAAGACAGTGTTGTTGGATATTATGTC
AAAGGCGAATGTCAATAAAATGACTTTGAAGATAATGAAAATTATTGA