Identifiers and Description

Gene Model Identifier

TTHERM_00048810

Standard Name

TIF1 (Type I element binding Factor )

Aliases

PreTt11261 | 3.m01664 | ssA-TIBF | 3824.m03019

Description

Type I element binding Factor; homotetramer (90 kDa) with 21 kDa subunit that binds to single-stranded type I elements and pause site elements (PSEs)."protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00048810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01673.12.9993072498124884e-122hypothetical protein (213 aa)
OxytrichaContig20804.0.g290.00000019998969434520019TIP41-like family

General Information

Paragraph NoGene NameParagraph Text
76TIF1Gene Information: Tif1 is a non-ORC Type-I binding factor associated with ssDNA, particularly rDNA associated with replication initiation. Essential cis-acting replication determinant in ribosomal DNA origin of replication. (Location 5’ non-transcribed spacer) Limited homology to Whirly family proteins in plants (transcription factors that bind to single strand DNA target sequences), but this homology is restricted to the DNA binding domain.
77TIF1Nucleic Acid Interactions: Tif1 assocates with the A-rich strand of rDNA in vivo, and can be purified to associate with the T-rich strand in vitro.
78TIF1Biochemical Activities: Regulates timing of rDNA origin activation. Involved in the S phase DNA damage checkpoint response. Involved in unique ssDNA origin of replication recognition. TIF1 disruption mutants are hypersensitive to hydroxyurea and methylmethanesulfonate, inducers of DNA damage in all examined eukaryotes.
79TIF1Regulation & Expression: TIF1 interacts with A-rich strand at the rDNA origins and the T-rich strand at the rDNA promoter. TIF1p localization is dynamically regulated as it moves into the micro- and macronucleus during the respective S phases.

Associated Literature

  1. Ref:18007594: Mohammad MM, Donti TR, Sebastian Yakisich J, Smith AG, Kapler GM (2007) Tetrahymena ORC contains a ribosomal RNA fragment that participates in rDNA origin recognition. The EMBO journal 26(24):5048-60
  2. Ref:17005912: Yakisich JS, Sandoval PY, Morrison TL, Kapler GM (2006) TIF1 activates the intra-S-phase checkpoint response in the diploid micronucleus and amitotic polyploid macronucleus of Tetrahymena. Molecular biology of the cell 17(12):5185-97
  3. Ref:15772155: Morrison TL, Yakisich JS, Cassidy-Hanley D, Kapler GM (2005) TIF1 Represses rDNA replication initiation, but promotes normal S phase progression and chromosome transmission in Tetrahymena. Molecular biology of the cell 16(6):2624-35
  4. Ref:12832485: Mohammad M, York RD, Hommel J, Kapler GM (2003) Characterization of a novel origin recognition complex-like complex: implications for DNA recognition, cell cycle control, and locus-specific gene amplification. Molecular and cellular biology 23(14):5005-17
  5. Ref:11577092: Saha S, Nicholson A, Kapler GM (2001) Cloning and biochemical analysis of the tetrahymena origin binding protein TIF1: competitive DNA binding in vitro and in vivo to critical rDNA replication determinants. The Journal of biological chemistry 276(48):45417-26
  6. Ref:10623536: Saha S, Kapler GM (2000) Allele-specific protein-DNA interactions between the single-stranded DNA-binding protein, ssA-TIBF, and DNA replication determinants in Tetrahymena. Journal of molecular biology 295(3):423-39
  7. Ref:10637338: Mohammad M, Saha S, Kapler GM (2000) Three different proteins recognize a multifunctional determinant that controls replication initiation, fork arrest and transcription in Tetrahymena. Nucleic acids research 28(3):843-51
  8. Ref:9753731: Yue M, Reischmann KP, Kapler GM (1998) Conserved cis- and trans-acting determinants for replication initiation and regulation of replication fork movement in tetrahymenid species. Nucleic acids research 26(20):4635-44
  9. Ref:7718560: Hou Z, Umthun AR, Dobbs DL (1995) A single-stranded DNA binding protein that specifically recognizes cis-acting sequences in the replication origin and transcriptional promoter region of Tetrahymena rDNA. Biochemistry 34(14):4583-92
  10. Ref:7971273: Umthun AR, Hou Z, Sibenaller ZA, Shaiu WL, Dobbs DL (1994) Identification of DNA-binding proteins that recognize a conserved type I repeat sequence in the replication origin region of Tetrahymena rDNA. Nucleic acids research 22(21):4432-40

Sequences

>TTHERM_00048810(coding)
ATGTTTTCGTATTTCAAAGGATTAGTAACAAAGAAGACATAGTTGTTCTTTTAACCCAAT
AATTAGTTCAGTGAAATTTGGAAAAAGAAAAAGAACATCATTATTAAGCCCTTCTCAATT
ATTTCAGGAGAAACTGTGTTTAGTGCTACCCCAATTAAAGGTAAATATGGAGTTAAAAAC
GACTATATAACAGTATTGAAGAATGGATGCATGCTCACTGAAGTTATTCCATGCTCTAAA
GATAATACAGGAAAAGTTAACATAGATTATAGTAAAAGATTAAATTTTGCTATGAGTCTT
TCTAACATGGGTTAAATATTGGCTATATCTGACGAGCTTATTTCTAAATCTACTATCAAC
ACCAAGATTGAATATACTTTATCATCTGATGTTAAGAAGAAAGCCCTTTACATAAGTAAA
AAACCTGAAGATACCCATTTAAATATATAAATCAAAGAAAGCAACTTATTACCTGATTAG
AATAAATGGGCTGACCATTTATTACAAGCAAATGTATCTGTTCCTGATTTTATTATCTTT
AGAGAACTTTGTAGATTTTCACTCCCTTACATGATTGGATGGTAAGCTTTAGCCTCTTAC
GACTTTGCTGAAAAAGATTCTAGTGATGATAGATTGTGA


>TTHERM_00048810(protein)
MFSYFKGLVTKKTQLFFQPNNQFSEIWKKKKNIIIKPFSIISGETVFSATPIKGKYGVKN
DYITVLKNGCMLTEVIPCSKDNTGKVNIDYSKRLNFAMSLSNMGQILAISDELISKSTIN
TKIEYTLSSDVKKKALYISKKPEDTHLNIQIKESNLLPDQNKWADHLLQANVSVPDFIIF
RELCRFSLPYMIGWQALASYDFAEKDSSDDRL


>TTHERM_00048810(gene)
ATGTTTTCGTATTTCAAAGGATTAGTAACAAAGAAGACATAGTTGTTCTTTTAACCCAAT
AATTAGTTCAGTGAAATTTGGAGTATAGAGATTGTTATTTTTTATAATTATTTTTTTTAA
AGCAAGATAAGTTAGTTATTATTAAGTTAAATGGATATTTATTTATTGATTTCTACTTTG
AGAATCTGGATTTAATAAAAATAATTGGAAAATATTTATGAAATATAGAAAAGAAAAAGA
ACATCATTATTAAGCCCTTCTCAATTATTTCAGGAGAAACTGTGTTTAGTGCTACCCCAA
TTAAAGTATGGTTTATAAAATATTTATTTATAATAAAGAGTTTATTTCTAAAATTGTCTT
AAAAAAATGTATTTAAAAATAATTAAAAAGGGTAAATATGGAGTTAAAAACGACTATATA
ACAGTATTGAAGAATGGATGCATGCTCACTGAAGTTATTCCATGCTCTAAAGATAATACA
GGAAAAGTAGATTTTTATTTTTTTCGATTCTCATGAATAAATTAATAAAATATAGAAATT
TCTAAATATCTTCTTAATAAATATAAAAGGTTAACATAGATTATAGTAAAAGATTAAATT
TTGCTATGAGTCTTTCTAACATGGGTTAAATATTGGCTATATCTGACGAGCTTATTTCTA
AATCTACTATCAACACCAGTAACTATTCAAATAATAAAATATTTGCAATTCTTAAACCAA
ATAATTGTTTTATATTGATTAATTAAAATGAATTTAATATTTTGATTAATTTAGATGAAA
TAAATTTAGAAACTTTAATAAATATTTTAATTTTCTAAAAGAGATTGAATATACTTTATC
ATCTGATGTTAAGAAGAAAGCCCTTTACATAAGTAAAAAACCTGAAGATACCCATTTAAA
TATATAAATCAAAGAAAGCAACTTAGTAATAATTATTCCAATTAGTTTCATTTATATTTC
AAAATTTTATCAAATTTTAATGTAATAAAAAAATTTAATTAAAAAGTTACCTGATTAGAA
TAAATGGGCTGACCATTTATTACAAGCAAATGTATCTGTTCCTGATTTTATTATCTTTAG
AGAACTTTGTAGAGTAAATAAATAATATTAAAAATTATCAATAATTAACTTGTTGCCATT
TAAAAAAGTTTTCACTCCCTTACATGATTGGATGGTAAGCTTTAGCCTCTTACGACTTTG
CTGAAAAAGATTCTAGTGATGATAGATTGTGA