Identifiers and Description

Gene Model Identifier

TTHERM_00327330

Standard Name

TIC1 (transmembrane ion channel 1)

Aliases

PreTt30236 | 33.m00248 | 3705.m00076

Description

cation channel family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR00145 ) FTR1 family protein
  • ( PF00520 ) transporter, cation channel family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.9%

TetraMine Data

TTHERM_00327330

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08575.19.997093137033517e-262cation channel family protein
(620 aa)

General Information

Paragraph NoGene NameParagraph Text
33TIC1Tetrahymena thermophile TIT1 is homologous with proteins from a cation channel family. It contains one domain: the ion transport protein (Evalue: 1x10⁻⁸) whose function is to selectively transport ions through the membrane. It is possible that this protein is an integral membrane protein that has a critical function in facilitating ion transport. Transmembrane Ion Channel Family proteins that are found in eukaryotes tend to have up to four additional transmembrane helices. These additional helices help explain the physical properties of the protein. We have determined that TIT1 has a sequence that consists of 604 amino acids, a relatively lengthy sequence. Paragraph by: Kristiana Kim and Will Su(undergraduates), Keck Science Department, Scripps College, Claremont McKenna College

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00327330(coding)
ATGGCAGATCTATTAAAATAAATAGAATAAGTATACCCTGAGCTGAATGTTCCAAATAAA
ATAAAGAACGCCTCAGTTAAAAAGTTTCTTGTCAGATTCAATGAAGCGTTTAATGTCGCA
ATAATTTTAACCTTATTTTTCACATTTATGGCACTGCCAGATGGATCATAAACTGAAAGG
TTTATTTTTAGAAGCATAAATGAAATATCCTCAATATTAATTTCTATAATGAGCATACTA
AATTTAATTCATTTGAAACACTTATACTTCGACTCTAAATACTATGGTGCTCCATTTGTT
TTGATTGACTTTTTATCAGGAGTATTTTGCATATTTTTAGACATCATTTCCCTTATCGTT
GGAAAAAATATGTTGGGTATTTATTATGCAGATGGATTTAGAATGCTAAAATTGTTTACA
TTCGAAAAATTAAGAATTATTATTAAGGATATTTTCTACGTGATGCCAAAAGCTAAAAAG
GTTTTCTTTTCTATGGTTTTCGTATTTTTCGTATTTTCATTGATTGGGTTCAAGCTCTTT
CATCATGTTAATGCTGAATAATTTAGAAATTTGTTTGTCTCTTTGCTATCAATGTTTTAA
GTTTTAACTTTCGATTCATGGAATGTACAAATGAATATTCCTATCATTAATAAATGGGGA
GGTCATTGGAGCATCTTCTTTATAATTGCTATCTTCCTACTCTAATTCTTCTATTTTAAC
TTCTTCTTAAGTGAATTCGTTACCTACTACAGCAATCGTAACTACAGAGTCAATTTTGTC
TATAAATATAATTAAGATGAAATTCACAACCATAAGTTAAAGGAATGGAGTAAAAGATAT
TTGAGTGTAAATGAAGTTTTAAAAGTGTTGAAAATAGAAAAGTCTGAAAAAGATTTAAGT
CTCATAGATTTTATTTTAGCTAACTACAAATATTTATATATTTTTGCAATCTTGTTTATT
GAGCTACTTAGAGTCTTTTTTAATCCACTTTTATTTGTTTATATTTTGGAAGTTATTGTT
GGATTACTTGCTATAATTGAATTCTCTTTAATCATTGAATAATTATAGTTAAAGGAAAAA
AAATCTATAAATGGTGATAAAAGCACTTTATAATAAATTTGTCAAAGCTCAAAATTAGTA
TTCTTGTTTTTAGCTGGGTTTGTTGGTTTTGCAGTAGACTTAATTTCTATGATCTATGGA
AATTATACATTGAATTATGGATCCTGTTTCAGAATCTTAGTTTTACTAACAACATATGAA
TGCTAATTCTCATTTATCAAGCTATCTTAAGTCTTTTCAAAAATCGGAGAGATGGGATTT
GTTAATTTAGCTATAATGTACACTTTGGCTATTATTGGATATTACTGCTTATACAGATTC
GATGTAACTTTTGGATTTTATTTTGAAGATGTGACAAACACTTACATGTATTTACTTCAA
ACAATTACTTTTGATGCTTGGGGAGATATTGCCAGAGCAGCTATGTTAATGAATCCTGTT
TATGCGATTTATTTTGCTTTCATGATTATTTTTATGGGATTTTTGCTTTAAAATTTCATG
GTTGGTACAATAGCTACTACTGTTTAGCCTGCTTGCGAAGATGAATTCAATCAATCAAGA
GTTTTATAGAGAAAAATATCATAATACTAAGTTAACATTTTGAGAGAAAGTCTTGGAAAT
TCATAATAATTCAATTAAAATTCATAAAATTTGAAAAAAGATTAAGAATCTACAGAAAAT
TTGAAGAAATTAAAAGAGATAATAGAAGAGTTTAACAAAGGCCAAGGTAATTTAACAGTT
ACTTTTGAAGGTAAAAGCTACGACCTCAAGTCTAAAAATATAATTAGCCTATAAAATTGA


>TTHERM_00327330(protein)
MADLLKQIEQVYPELNVPNKIKNASVKKFLVRFNEAFNVAIILTLFFTFMALPDGSQTER
FIFRSINEISSILISIMSILNLIHLKHLYFDSKYYGAPFVLIDFLSGVFCIFLDIISLIV
GKNMLGIYYADGFRMLKLFTFEKLRIIIKDIFYVMPKAKKVFFSMVFVFFVFSLIGFKLF
HHVNAEQFRNLFVSLLSMFQVLTFDSWNVQMNIPIINKWGGHWSIFFIIAIFLLQFFYFN
FFLSEFVTYYSNRNYRVNFVYKYNQDEIHNHKLKEWSKRYLSVNEVLKVLKIEKSEKDLS
LIDFILANYKYLYIFAILFIELLRVFFNPLLFVYILEVIVGLLAIIEFSLIIEQLQLKEK
KSINGDKSTLQQICQSSKLVFLFLAGFVGFAVDLISMIYGNYTLNYGSCFRILVLLTTYE
CQFSFIKLSQVFSKIGEMGFVNLAIMYTLAIIGYYCLYRFDVTFGFYFEDVTNTYMYLLQ
TITFDAWGDIARAAMLMNPVYAIYFAFMIIFMGFLLQNFMVGTIATTVQPACEDEFNQSR
VLQRKISQYQVNILRESLGNSQQFNQNSQNLKKDQESTENLKKLKEIIEEFNKGQGNLTV
TFEGKSYDLKSKNIISLQN


>TTHERM_00327330(gene)
ATGGCAGATCTATTAAAATAAATAGAATAAGTATACCCTGAGCTGAATGTTCCAAGTAAA
AAAAGTTTTTAATACATATTTATTAGCACATCTTTTTGATTTTATTTAAGTAGATGATTT
TAGCATTTTGAGAAATTTAAAATTAATTATTGAATATAGATAAAATAAAGAACGCCTCAG
TTAAAAAGTTTCTTGTCAGATTCAATGAAGCGTTTAATGTCGCAATAATTTTAACCTTAT
TTTTCACATTTATGGCACTGCCAGAGTAATATTTTGATATTTAAAACAAAAATTAATTGC
TTTTAATAAATTAAAAAGTGGATCATAAACTGAAAGGTTTATTTTTAGAAGCATAAATGA
AATATCCTCAATATTAATTTCTATAATGAGCATACTAAATTTAATTCATTTGAAACACTT
ATACTTCGACTCTAAATACTATGGTAAAAGAAATCTTTTATTTTAATTTTTTACAAAATA
GTCTAATAAATATTCATTTTTCAACTAATATTTGAGTTAAGTTATTATAATAAGATAAGT
AACATTTGGTATTGAATCCTAAAAATCTAATAAAAATTAAATACAACATAAATTAAAATG
ATTTTTTTTAAAATATCTTTTTCATTTTTTATTTGAAAAATAATTTTATTTATTTTTTAA
ATTCAGGTGCTCCATTTGTTTTGATTGACTTTTTATCAGGAGTATTTTGCATATTTTTAG
ACATCATTTCCCTTATCGTTGGAAAAAATATGTTGGGTATTTATTATGCAGATGGATTTA
GAATGCTAAAATTGTTTACATTCGAAAAATTAAGGTAGATTGATAAATTAATTACTTTCT
ATCTTTAAAAACTTTAAAATATTTTTTAGAATTATTATTAAGGATATTTTCTACGTGATG
CCAAAAGCTAAAAAGGTTTTCTTTTCTATGGTTTTCGTATTTTTCGTATTTTCATTGATT
GGGTTCAAGCTCTTTCATCATGTTAATGCTGAATAATTTAGAAATTTGTTTGTCTCTTTG
CTATCAATGTTTTAAGTAAATCAAATTTGTCAAAAAATATTTTAAACCTCTCGAATAAAA
AAAATAATAAAAAAATAAATAGGTTTTAACTTTCGATTCATGGAATGTACAAATGAATAT
TCCTATCATTAATAAATGGGGAGGTCATTGGAGCATCTTCTTTATAATTGCTATCTTCCT
ACTCTAATTCTTCTATTTTAACTTCTTCTTAAGTGAATTCGTTACCTACTACAGCAATCG
TAACTACAGAGTCAATTTTGTAAGATTTGATATAAATAAATTGATTTTTTTATTTTTCCA
GATTTTAAATTTTTAGCTATTTAATTAAAATAAACAAATTAATTTTTAATAAATATTAGG
TCTATAAATATAATTAAGATGAAATTCACAACCATAAGTTAAAGGAATGGAGTAAAAGAT
ATTTGAGTGTAAATGAAGTTTTAAAAGTGTTGAAAATAGAAAAGTCTGAAAAAGATTTAA
GTCTCATAGATTTTATTTTAGCTAACTACAAATATTTATATATTTTTGCAATCTTGTTTA
TTGAGCTACTTAGAGTCTTTTTTAATCCACTTTTATTTGTTTATATTTTGGAAGTTATTG
TTGGATTACTTGCTATAATTGAATTCTCTTTAATCGTAACTATCTTTAATTTTAATTTTA
ATTTAAATTCTTTTCTTGCTTCTTGAAAAAATTAATATTATCCTATAAATTTATTTTTAA
TTTAGATTGAATAATTATAGTTAAAGGAAAAAAAATCTATAAATGGTGATAAAAGCACTT
TATAATAAATTTGTCAAAGCTCAAAATTAGTATTCTTGTTTTTAGCTGGGTTTGTTGGTT
TTGCAGTAGACTTAATTTCTATGATCTATGGAAATTATACATTGAATTATGGATCCTGTT
TCAGAATCTTAGTTTTACTAACAACATATGAATGCTAATTCTCATTTATCAAGCTATCTT
AAGTCTTTTCAAAAGTAATTTTTGTTATTATTGATTAATAAAATTATTTTTTTTATTTAT
TTAATTTGTTTAATGTAAATTCTTAATAATTTTTATGATACTATTTAAAAAAAATGAAAA
TAAAATGATTAAACATATTCAAAAAAATTAATTTTTTTATTATAGATCGGAGAGATGGGA
TTTGTTAATTTAGCTATAATGTACACTTTGGCTATTATTGGATATTACTGCTTATACAGA
TTCGATGTAACTTTTGGATTTTATTTTGAAGATGTGACAAACACTTACATGTATTTACTT
CAAACAATTACTTTTGATGCTTGGGGAGATATTGCCAGAGCAGCTATGTTAATGGTAAAA
TTTCATAAGTAAATATTAAATTTTTAAATATTTTTTATGAAAAAGAATCCTGTTTATGCG
ATTTATTTTGCTTTCATGATTATTTTTATGGGATTTTTGCTTTAAAATTTCATGGTTGGT
ACAATAGCTACTACTGTTTAGCCTGCTTGCGAAGATGAATTCAATCAATCAAGAGTTTTA
TAGAGAAAAATATCATAATACTAAGTTAACATTTTGAGAGAAAGTCTTGGAAATTCATAA
TAATTCAATTAAAATTCATAAAATTTGAAAAAAGATTAAGAATCTACAGAAAATTTGAAG
AAATTAAAAGAGATAATAGAAGAGTTTAACAAAGGCCAAGGTAATTTAACAGTTACTTTT
GAAGGTAAAAGCTACGACCTCAAGTCTAAAAATATAATTAGCCTATAAAATTGA