Identifiers and Description

Gene Model Identifier

TTHERM_00085230

Standard Name

THG1 (tRNA His guanylyltransferase 1)

Aliases

PreTt16371 | 6.m00445 | 3836.m02038

Description

tRNAHis guanylyltransferase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF04446 ) tRNAHis guanylyltransferase
  • ( PF08112 ) ATP synthase epsilon subunit
  • ( PF08946 ) Osmosensory transporter coiled coil

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00085230

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02431.19.997093137033517e-262tRNAHis guanylyltransferase (3
41 aa)
OxytrichaContig358.0.g963.0013832822195203e-89tRNAHis guanylyltransferase
DictyBaseDDB_G02918308.997587713565275e-70thg1 on chromosome: 6 position
833386 to 834358
SGDYGR024C8.000035279590482e-64THG1 tRNAHis guanylyltransfera
se, adds a guanosine residue t
o the 5 end of tRNAHis after t
ranscription and RNase P cleav
age; couples nuclear division
and migration to cell budding
and cytokinesis; essential enz
yme conserved among eukaryotes
Stentor CoeruleusSteCoe_54691.0806392777072785e-30

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00085230(coding)
ATGGCTTGCTCCCAATATGAATATGTTAAAAAATTCGAAACATACTAAACCCTTTTGCCT
AATACTTACATAGTAGTTAGAATTGACGGAAAAGGATTTACTAAATTTACTGCAAATCAC
AATTTTGAAAAACCAAACGACAAAAGAGGTTTAGATTTAATGAACAAAGCAGCTGAGAGT
GTTATGGAAACATTTAATGAAATTATGTTGGCTTATGGCTAATCTGATGAGTTCTCTTTT
GTTTTCAAAAAAGATGCTGAATTATACTAAAGAAGAACTGAAAAAATAGTTTCATGTGTA
GTTTCTTGCTTTACTGCTGCTTATGCTATGCATTTTAGCGACTACTTCAATATTAAACCT
TCTTTTTTACCTATGTTTGATGCTAGAGCAGTTTGCTACCCTGATTTTAAAAATTTAAGG
GATTACCTCAACTGGAGACAAGTTGATTGTCACATTAACAATCTTTACAATACTTGTTTT
TGGACTATGGTCCAGAAGGGAAACATGACTCCTTAGAAAGCATAAGAAATCCTGAAAGAT
ACCTTAAGCGATAGAAAAAATGAAATATTATTTAATGATTATGGAATTAACTATGCAAAG
TTAGAACCTCAATTCAGAAAAGGATCCACTTTAATAAGAGTTTTAGTTCTCAAAGATAAG
CATGCTAACAAAGAAGCAGAATAAGCGGAATCTTAACAAAAAAGAGAAAAATGTGAAGAA
AATTAAGGATTAAACAAAGAAGGTGCTTTATAGTAGTAAAATGAAGAGGGAGAAGAACAA
AAAGAGAATGCAGAAGAACTTCTAAAGGAGGAATCTGATTCTGTAATGACAAAAGGAGAA
AAAAAATATATCGCTGGATAGAAAAAGTAGAAGAAATTAAATAGCAAGTAGCTAGAAAAG
ATTGAAAAAAGTAAATATCGCTCAAAAATAATTACATTATCTGACGACATAATCTAAAAT
GAATTTTGGGATAAGTACAAAGACTCGCTAAAGCTTCAAGAGTGA


>TTHERM_00085230(protein)
MACSQYEYVKKFETYQTLLPNTYIVVRIDGKGFTKFTANHNFEKPNDKRGLDLMNKAAES
VMETFNEIMLAYGQSDEFSFVFKKDAELYQRRTEKIVSCVVSCFTAAYAMHFSDYFNIKP
SFLPMFDARAVCYPDFKNLRDYLNWRQVDCHINNLYNTCFWTMVQKGNMTPQKAQEILKD
TLSDRKNEILFNDYGINYAKLEPQFRKGSTLIRVLVLKDKHANKEAEQAESQQKREKCEE
NQGLNKEGALQQQNEEGEEQKENAEELLKEESDSVMTKGEKKYIAGQKKQKKLNSKQLEK
IEKSKYRSKIITLSDDIIQNEFWDKYKDSLKLQE


>TTHERM_00085230(gene)
ATGGCTTGCTCCCAATATGAATATGTTAAAAAATTCGAAACATACTAAACCCTTTTGCCT
AATACTTACATAGTAGTTAGAATTGACGGAAAAGGATTTACTAAATTTACTGCAAATCAC
AATTTTGAAAAACCAAACGACAAAAGAGGTTTAGATTTAATGAACAAAGCAGCTGAGAGT
GTTATGGAAACATTTAATGAAATTATGTTGGCTTATGGCTAATCTGATGAGTTCTCTTTT
GTTTTCAAAAAAGATGCTGAATTATACTAAAGAAGAACTGAAAAAATAGTTTCATGTGTA
GTTTCTTGCTTTACTGCTGCTTATGCTATGCATTTTAGCGACTACTTCAATATTAAACCT
TCTTTTTTACCTATGTTTGATGCTAGAGCAGTTTGCTACCCTGATTTTAAAAATTTAAGG
GATTACCTCAACTGGAGACAAGTTGATTGTCACATTAACAATCTTTACAATACTTGTTTT
TGGACTATGGTCCAGAAGGGAAACATGACTCCTTAGAAAGCATAAGAAATCCTGAAAGAT
ACCTTAAGCGATAGAAAAAATGAAATATTATTTAATGATTATGGAATTAACTATGCAAAG
TTAGAACCTCAATTCAGAAAAGGATCCACTTTAATAAGAGTTTTAGTTCTCAAAGATAAG
CATGCTAACAAAGAAGCAGAATAAGCGGAATCTTAACAAAAAAGAGAAAAATGTGAAGAA
AATTAAGGATTAAACAAAGAAGGTGCTTTATAGTAGTAAAATGAAGAGGGAGAAGAACAA
AAAGAGAATGCAGAAGAACTTCTAAAGGAGGAATCTGATTCTGTAATGACAAAAGGAGAA
AAAAAATATATCGCTGGATAGAAAAAGTAGAAGAAATTAAATAGCAAGTAGCTAGAAAAG
ATTGAAAAAAGTAAATATCGCTCAAAAATAATTACATTATCTGACGACATAATCTAAAAT
GAATTTTGGGATAAGTACAAAGACTCGCTAAAGCTTCAAGAGTGA