Identifiers and Description

Gene Model Identifier

TTHERM_00242580

Standard Name

THD9 (Tetrahymena Histone Deacetylase 9)

Aliases

PreTt18995 | 20.m00459 | 3706.m00223

Description

Sir2-like histone deacetylase; suppresses DNA transcription by deacetylation of histones

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF02146 ) transcriptional regulator, Sir2 family
  • ( PF00205 ) Thiamine pyrophosphate enzyme, central domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00242580

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07749.19.997093137033517e-262transcriptional regulator, Sir
2 family protein (446 aa)
OxytrichaContig19063.0.g744.001202823045957e-54Sir2 family
Stentor CoeruleusSteCoe_105972.9374821117108028e-30
DictyBaseDDB_G02839178.999890565246037e-26sir2A on chromosome: 4 positio
n 1272110 to 1273864
WormBaseWBGene000048032.999534586690157e-23locus:sir-2.4 NAD-dependent
protein deacetylase sir-2.4
status:Confirmed UniProt:Q95
Q89 protein_id:CCD61225.1
SGDYOL068C3.001003044337619e-17HST1 NAD(+)-dependent histone
deacetylase; essential subunit
of the Sum1p/Rfm1p/Hst1p comp
lex required for ORC-dependent
silencing and mitotic repress
ion; non-essential subunit of
the Set3C deacetylase complex;
involved in telomere maintena
nce

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18178773: Smith JJ, Torigoe SE, Maxson J, Fish LC, Wiley EA (2008) A class II histone deacetylase acts on newly synthesized histones in Tetrahymena. Eukaryotic cell 7(3):471-82
  2. Ref:SUPR000220
  3. Ref:SUPR000127

Sequences

>TTHERM_00242580(coding)
ATGAAAATTAATAAATTCATTAAAAAAGCGTTCTCTACTATTTAGGAAAGCGAATATAGC
AAATACTTTTCTAAAAACTCTGTATACCATTAGAAAGATAAGTTCTTGTTTAATCCTAGA
CTTAAAGATACTTAAGAGCATTAAGATTCACCAGAATAAATAGATACCAAAGTAAATCAG
CTTATAGAATTACTTTAAAAAAGTAAGAATGCTGTGATATTAACTGGAGCTGGAGTTAGT
ACAGCTTCAGGTATACCTGATTATAGAAGTGGTGCAAATACTATTTTAAAAACAGGACCT
GGTAAGTGGGAATTAGAGGAAAACAAAAAAAAATTTTTGGAAGAAAAAGGTAAGCCATAA
ATAATATTAGCAATAAATGCATTCCCTTCTCCAACTCATATGGCAATTTCAAAACTATAT
AAAGAGAATTTGATAAAATCAGTAATTACTTAAAATGTTGATAACTTGCATCATTAAAGT
GGTATTCCAAGGAAAGATATTCATGAGCTGCATGGGAATATTATTTCAGAGAGATGTGAA
AAGTGTAATTATGTCCATTATAGAGATTTTTATACTCGTTTAAAACATTTGAAATGGGGA
GATCCACATAACACTGGAAGAATTTGCTAAAAAAATGGATGTGATGGATAATTGCACGAC
ACTTTGGTATTTTTTGGAGAATCAGTATTACAAAATATAAAATAATCAGCATAAGAATAA
ATTGAAAGTGCAGATTTGTGCATAGTGGTAGGAACGAGCTTGACAGTTTAATCTGCAGCT
AGGTTAGTTTGGATTTCTTAGTAAAGAGGAATTCCTATAGTAATAATAAATCTACAAAAA
ACAAGCTATGATTCGAAGGCACTTAAAATTAATGGTTTATGTGAACCTATCTTTGATTTG
ATTCTTAAAAAACTTAATTTCTAGCCCGATAAATTTACAGTTTAAAGGGATATTATATTG
AGATTTTAGAAAACTGGGTTTTGCAGCTTTGATTTGTTTGCTGACTGTGAAAGTTTTGAT
GGAAGCCATTTGAGTGCTATTAAATAATTAGAAATTTGGTATAGAAAAGAAAATGGAAAT
TAATTATATAAAAGCTTTGAAGGTCATCCATACTATTTTTAAGCTGAAGATTCATTTAAC
ATAGATCAAATTAAATTAAATTTTTTTTCTCACCATAAAGAAAAGAGTCACTTTATTTAT
GACTAGGAGGTATTATAAAATGGATAGCTATTTAGTATGAGCTCTCCAGGGTCATTAATT
TTCCTTACATCTAAATTAACATATGAATTTTAAGATTAAAAAGATGAATGGATTGCTTAA
CATAAAATTGAAAGCTACAAATGA


>TTHERM_00242580(protein)
MKINKFIKKAFSTIQESEYSKYFSKNSVYHQKDKFLFNPRLKDTQEHQDSPEQIDTKVNQ
LIELLQKSKNAVILTGAGVSTASGIPDYRSGANTILKTGPGKWELEENKKKFLEEKGKPQ
IILAINAFPSPTHMAISKLYKENLIKSVITQNVDNLHHQSGIPRKDIHELHGNIISERCE
KCNYVHYRDFYTRLKHLKWGDPHNTGRICQKNGCDGQLHDTLVFFGESVLQNIKQSAQEQ
IESADLCIVVGTSLTVQSAARLVWISQQRGIPIVIINLQKTSYDSKALKINGLCEPIFDL
ILKKLNFQPDKFTVQRDIILRFQKTGFCSFDLFADCESFDGSHLSAIKQLEIWYRKENGN
QLYKSFEGHPYYFQAEDSFNIDQIKLNFFSHHKEKSHFIYDQEVLQNGQLFSMSSPGSLI
FLTSKLTYEFQDQKDEWIAQHKIESYK


>TTHERM_00242580(gene)
ATGAAAATTAATAAATTCATTAAAAAAGCGTTCTCTACTATTTAGGAAAGCGAATATAGC
AAATACTTTTCTAAAAACTCTGTATACCATTAGAAAGATAAGTTCTTGTTTAATCCTAGA
CTTAAAGATACTTAAGAGCATTAAGATTCACCAGAATAAATAGATACCAAAGTAAATCAG
CTTATAGAATTACTTTAAAAAAGTAAGAATGCTGTGATATTAACTGGAGCTGGAGTTAGT
ACAGCTTCAGGTATACCTGATTATAGAAGTGGTGCAAATACTATTTTAAAAACAGGACCT
GGTAAGTGGGAATTAGAGGAAAACAAAAAAAAATTTTTGGAAGAAAAAGGTAAGCCATAA
ATAATATTAGCAATAAATGCATTCCCTTCTCCAACTCATATGGCAATTTCAAAACTATAT
AAAGAGAATTTGATAAAATCAGTAATTACTTAAAATGTTGATAACTTGCATCATTAAAGT
GGTATTCCAAGGAAAGATATTCATGAGCTGCATGGGAATATTATTTCAGAGAGATGTGAA
AAGTGTAATTATGTCCATTATAGAGATTTTTATACTCGTTTAAAACATTTGAAATGGGGA
GATCCACATAACACTGGAAGAATTTGCTAAAAAAATGGATGTGATGGATAATTGCACGAC
ACTTTGGTATTTTTTGGAGAATCAGTATTACAAAATATAAAATAATCAGTAAAATTAATA
TGAGAATTAGGGATTTAAATATACTTTTATTTAATTAATTAATAAACTCTACTTATAAAG
TAGAAAAAAGACTATACCTCCTTTATTTAATTTAATTTTTTTATTAATATTAAAAGGCAT
AAGAATAAATTGAAAGTGCAGATTTGTGCATAGTGGTAGGAACGAGCTTGACAGTTTAAT
CTGCAGCTAGGTTAGTTTGGATTTCTTAGTAAAGAGGAATTCCTATAGTAATAATAAATC
TACAAAAAACAAGCTATGATTCGAAGGCACTTAAAATTAATGGTTTATGTGAACCTATCT
TTGATTTGATTCTTAAAAAACTTAATTTCTAGCCCGATAAATTTACAGTTTAAAGGTAAA
TATTTGAATTTATTTTTTAAAATGTAAAGCTACTTGTGTCAAATTAATATAATTTCGCTA
AAAGAAATATTTAATCTTACTCATTAAATTTTTATTTAAAAAAAAGCTTTTTTACATTTT
GCATTAAATTTTTTTAAATACATATTTTTGTTTTTTAATATGAAATTAAGGGATATTATA
TTGAGATTTTAGAAAACTGGGTTTTGCAGCTTTGATTTGTTTGCTGACTGTGAAAGTTTT
GATGGAAGCCATTTGAGTGCTATTAAATAATTAGAAATTTGGTATAGAAAAGAAAATGGA
AATTAATTATATAAAAGCTTTGAAGGTCATCCATACTATTTTTAAGCTGAAGATTCATTT
AACATAGATCAAATTAAATTAAATTTTTTTTCTCACCATAAAGAAAAGAGTCACTTTATT
TATGACTAGGAGGTATTATAAAATGGATAGCTATTTAGTATGAGCTCTCCAGGGTCATTA
ATTTTCCTTACATCTAAATTAACATATGAATTTTAAGATTAAAAAGATGAATGGATTGCT
TAACATAAAATTGAAAGCTACAAATGA