Identifiers and Description

Gene Model Identifier

TTHERM_00031680

Standard Name

THD7 (Tetrahymena Histone Deacetylase 7)

Aliases

PreTt14300 | 2.m02084 | 3825.m02684

Description

Zn-finger in ubiquitin-hydrolases and other protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.4%

TetraMine Data

TTHERM_00031680

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00865.18.003007177279125e-133Zn-finger in ubiquitin-hydrola
se (277 aa)
WormBaseWBGene000183192.000769134519826e-18locus:hda-6 status:Confirmed
UniProt:G8JYB7 protein_id
:CCD71107.1
DictyBaseDDB_G02839174.997543945741262e-17sir2A on chromosome: 4 positio
n 1272110 to 1273864
OxytrichaContig18612.0.g70.000000000000001999258566166494Zn-finger in ubiquitin-hydrola
ses and other protein
Stentor CoeruleusSteCoe_284570.0000000000006914400106940203
SGDYBR058C0.00000030014504373857585UBP14 Ubiquitin-specific prote
ase that specifically disassem
bles unanchored ubiquitin chai
ns; involved in fructose-1,6-b
isphosphatase (Fbp1p) degradat
ion; similar to human isopepti
dase T

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18178773: Smith JJ, Torigoe SE, Maxson J, Fish LC, Wiley EA (2008) A class II histone deacetylase acts on newly synthesized histones in Tetrahymena. Eukaryotic cell 7(3):471-82
  2. Ref:SUPR000094
  3. Ref:SUPR000092

Sequences

>TTHERM_00031680(coding)
ATGATAAATTTATAGGCAGGATAGGCTTTTATAGATCCATTTACAGGCGAAGAAGCATTT
GCAGTAGAACCTATTACTAATTGTCCACACGCTCTAAAGCTAGATTTGAAAAAAACAGAA
GAGACTATTTATCAGAAAAGATAATAGTTATTTTGGAGTTAATGTAGCAATTGTGAAAAT
GTTGGTGAAAATTGGTTTTGCTTAATTTGTAATAACGTCTATTGCAGTAGGTATGTTAAA
GGTCATATGGCTATGCATAATTAATAGAATTAAGATCATTAAGTTGCTGTTAGTTTTTCT
GATTTAAGCTTTTGGTGTTACGAATGTGATTCTTATATAACAAATTAAGACCTTTCCAAG
TTGAGAAAATTATTTTAAAAGGCTAAATTTAATGAAGGAGATTTTTCTTAAAAGCAGAAT
TTAGTATCATAAAGTGATAAGAATCATGAAGAAATTAGTTAAAAAGCCATCAACGGTAAT
GGATTTTTTGTAGCAGGAGATATTAAAGAATAAAAGGTTTATTAAGTACTAATTTTAAGT
TAGTTTTAGAAAGATATAATTGTGTAAAAAGGAGTGTTAAAGGGATATTAAATTTAAAAT
AGTAAAAGTAATTATGCTTAACAAATTATAAAAAATGAAAGTGAAGAAGTTTTGGGATCT
GTTATAAGATTTGGAAAAAATTTGGAGCAAGTAACCAGAGAAAAGATAGCCTATTTAATG
AATGAAATAGAAGGATTTCCCATTCACACTTCAATTAAATTTGAAAAAGTAATTTCTGGA
GAAGAATAATTAGAGTTAGCTATTTATTGCTTAGATGATTGA


>TTHERM_00031680(protein)
MINLQAGQAFIDPFTGEEAFAVEPITNCPHALKLDLKKTEETIYQKRQQLFWSQCSNCEN
VGENWFCLICNNVYCSRYVKGHMAMHNQQNQDHQVAVSFSDLSFWCYECDSYITNQDLSK
LRKLFQKAKFNEGDFSQKQNLVSQSDKNHEEISQKAINGNGFFVAGDIKEQKVYQVLILS
QFQKDIIVQKGVLKGYQIQNSKSNYAQQIIKNESEEVLGSVIRFGKNLEQVTREKIAYLM
NEIEGFPIHTSIKFEKVISGEEQLELAIYCLDD


>TTHERM_00031680(gene)
ATGATAAATTTATAGGCAGGATAGGCTTTTATAGATCCATTTACAGGCGAAGAAGCATTT
GCAGTAGAACCTATTACTAATTGTCCACACGCTCTAAAGCTAGATTTGAAAAAAACAGAA
GAGACTATTTATCAGAAAAGATAATAGTTATTTTGGAGTTAATGTAGCAATTGTGAAAAT
GTTGGTGAAAATTGGTTTTGCTTAATTTGTAATAACGTCTATTGCAGTAGGTATGTTAAA
GGTCATATGGCTATGCATAATTAATAGAATTAAGATCATTAAGTTGCTGTTAGTTTTTCT
GATTTAAGCTTTTGGTGTTACGAATGTGATTCTTATATAACAAATTAAGACCTTTCCAAG
TTGAGAAAATTATTTTAAAAGGCTAAATTTAATGAAGTAAGTAAATTAAATGTTTTATTA
TTAAAATTAATTTTAGCTGTTTATTACATTAAATATTTTATTTACATTATTAAGTATTCA
TTTTTTAAATAACAATTTCTATAAAATCATATGTTTTTAAACATGAACATCAAAATTAAA
TCAAAAATAGGGAGATTTTTCTTAAAAGCAGAATTTAGTATCATAAAGTGATAAGAATCA
TGAAGAAATTAGTTAAAAAGCCATCAACGGTAATGGATTTTTTGTAGCAGGAGATATTAA
AGAATAAAAGGTTTATTAAGTACTAATTTTAAGTTAGTTTTAGAAAGATATAATTGTGTA
AAAAGGAGTGTTAAAGGGATATTAAATTTAAAATAGTAAAAGTAATTATGCTTAACAAAT
TATAAAAAATGAAAGTGAAGAAGTTTTGGGATCTGTTATAAGATTTGGAAAAAATTTGGA
GCAAGTAACCAGAGAAAAGATAGCCTATTTAATGAATGAAATAGAAGGATTTCCCATTCA
CACTTCAATTAAATTTGAAAAAGTAATTTCTGGAGAAGAATAATTAGAGTTAGCTATTTA
TTGCTTAGATGATTGA