Identifiers and Description

Gene Model Identifier

TTHERM_00502610

Standard Name

THD6 (Tetrahymena histone deacetylase 6)

Aliases

PreTt08100 | 63.m00278 | 3716.m00130 | THD6

Description

Histone deacetylase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00850 ) Histone deacetylase family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00502610

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09551.19.997093137033517e-262histone deacetylase (457 aa)
WormBaseWBGene000018362.0005528695435914e-146locus:hda-3 Histone deacetyl
ase status:Confirmed UniPr
ot:G5ECH0 protein_id:CAB0322
4.1
DictyBaseDDB_G02680245.002003259710477e-145hdaA on chromosome: 1 position
1320084 to 1322172
SGDYNL330C1.0004982362389172e-141RPD3 Histone deacetylase; regu
lates transcription, silencing
, and other processes by influ
encing chromatin remodeling; f
orms at least two different co
mplexes which have distinct fu
nctions and members
OxytrichaContig1866.0.g683.001349705199738e-130Histone deacetylase domain
Stentor CoeruleusSteCoe_315542.8946403116483003e-63

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18178773: Smith JJ, Torigoe SE, Maxson J, Fish LC, Wiley EA (2008) A class II histone deacetylase acts on newly synthesized histones in Tetrahymena. Eukaryotic cell 7(3):471-82
  2. Ref:SUPR000098

Sequences

>TTHERM_00502610(coding)
ATGGAAGATGATATTAGAACAATTTATGAAGGGAAAAGAATTAGTTATTTCTATAATCCT
GAAATAGGAAAGTTTTACTACAGCAAAGATCACCCTATGAAACCAAAAAGAGTTGCTATG
GCACATTCTTTAATTTAAAATTTTGGTCTGTATAAAGACTTAGATGTTTACACTGCTCGT
TAAGCTACTTTTGAAGAAATGATCAAATTTCACGATATAGAATATATTAATTATCTACAA
AATTATGTTAGTAATGGTTGGACATAAGAGCTAAAAAAGCTGAAACAAGATCCCTTAATA
AATTTAGAATCTTCATACCATATAAATAACCCTAAAAAAAGATAAACAAGCAAAGTAGGA
GATACTTCTGATTGCCCAGGTTTTGAAGGTCTTTATAATTTTTGTTAGATTAGTGCTGGT
GGTTCTTTAGATTGCGCATCAATGATTATAAATCAATAATCTGATATTGCTATCAACTGG
GGAGGTGGTTTACATCATGCAAAGAAAAAAGAAGCTAGTGGATTTTGTTATGTTAATGAT
ATTGTTTTGTGTGCATTAGAGTTATTAAAGTATTATCCAAGAGTAATTTATATTGATATT
GATGTTCATCATGGCGATGGTGTAGAAGAAGCTTTTTTCCTTACAAATCGTGTGATGACA
GTTAGTTTTCATGAATATGGTGATGACTTCTTCCCAGGAAGTGGCTCTCTAAATTCTATT
GGCGATGGACCAGGCAAATATCATGCTATTAATGTACCTTTAAGACCAGGAATCAATGAT
GAAACATTTGAACAAGTATTTAAGGATGTTATGAAAAAAGTAATGGAAGTATATAGACCT
AATGTAATATTGCTATAATGCGGAGCTGATTCATTAGCATATGATAAGCTAGGACACTTC
AATTTATCAACAAAAGGGCATGGAAAAGCTGTAGAATATATGAAAAGCTTTGGTATTCCT
CTAATATTAATGGGAGGTGGTGGTTATAATGTACCAAATGTTGCAAGATGCTGGGCTTAT
GAGACATCTATTTGTGTTGGAAATAAAATTGATGGAAATATTCCTATTACTGAGCCGTTT
TATGACTATTTTGGTCCAGATCATAAACTCCATGTTACTCCTAAAAATAATGTGGATAAT
AAAAATACCAAGGATGAGCTCCATTAGAAGGTTTCAACCGTTCATGAATATTTAAGATAA
ATAGAAAGTGCACCTTCTATGGCATTCCATCACACCCCTGATAATAGTAAATTTGCAGAA
GAAGAATAAAATATAGATGAAGAATTTGATTATGATATGGATGATGAAGAGTTAGAAAGA
TATTTTAAATAGAAAGAAAAACCTATTATAATGAATAATAGATATATTTGA


>TTHERM_00502610(protein)
MEDDIRTIYEGKRISYFYNPEIGKFYYSKDHPMKPKRVAMAHSLIQNFGLYKDLDVYTAR
QATFEEMIKFHDIEYINYLQNYVSNGWTQELKKLKQDPLINLESSYHINNPKKRQTSKVG
DTSDCPGFEGLYNFCQISAGGSLDCASMIINQQSDIAINWGGGLHHAKKKEASGFCYVND
IVLCALELLKYYPRVIYIDIDVHHGDGVEEAFFLTNRVMTVSFHEYGDDFFPGSGSLNSI
GDGPGKYHAINVPLRPGINDETFEQVFKDVMKKVMEVYRPNVILLQCGADSLAYDKLGHF
NLSTKGHGKAVEYMKSFGIPLILMGGGGYNVPNVARCWAYETSICVGNKIDGNIPITEPF
YDYFGPDHKLHVTPKNNVDNKNTKDELHQKVSTVHEYLRQIESAPSMAFHHTPDNSKFAE
EEQNIDEEFDYDMDDEELERYFKQKEKPIIMNNRYI


>TTHERM_00502610(gene)
ATGGAAGATGATATTAGAACAATTTATGAAGGGAAAAGAATTAGTTATTTCTATAATCCT
GAAATAGGAAAGTATTGCATTTATACTTAGCACATATTAGAGCTTATATTAAACTTTTAT
AATATCATTAAATTTAACAAATCTATAATTAATAATATTTTTAGGTTTTACTACAGCAAA
GATCACCCTATGAAACCAAAAAGAGTTGCTATGGCACATTCTTTAATTTAAAATTTTGGT
CTGTATAAAGACTTAGATGTTTACACTGCTCGTTAAGCTACTTTTGAAGAAATGATCAAA
TTTCACGATATAGAATATATTAATTATCTACAAAATTATGTTAGTAATGGTTGGACATAA
GAGCTAAAAAAGCTGAAACAAGATCCCTTAATAAATTTAGAATCTTCATACCATATAAAT
AACCCTAAAAAAAGATAAACAAGCAAGTATTGCATATTTTTTAATTTATCTAATTACTTT
GCATCTTTACTTTTTATATTGAACTCATCTATATAAAAATATAGAGTAGGAGATACTTCT
GATTGCCCAGGTTTTGAAGGTCTTTATAATTTTTGTTAGATTAGTGCTGGTGGTTCTTTA
GATTGCGCATCAATGATTATAAATCAATAATCTGATATTGCTATCAACTGGGGAGGTGGT
TTACATCATGCAAAGAAAAAAGAAGCTAGTGGATTTTGTTATGTTAATGATATTGTTTTG
TGTGCATTAGAGTTATTAAAGTATTATCCAAGAGTAATTTATATTGATATTGATGTTCAT
CATGGCGATGGTGTAGAAGAAGCTTTTTTCCTTACAAATCGTGTGATGACAGTTAGTTTT
CATGAATATGGTGATGACTTCTTCCCAGGTAACATATTTGTTTATGAATCATATAGCTTT
TTGAAATAGATTTAGAAGTTAATAATAAATCATAAATTAAAAAAAAAAATAAATCCAAGC
TTTGAAAATAGAATTATTATAAATCATAATGAGAATTCAATTTTTTAAAAATAAAAATTG
TTTATTTAAATAGGAAGTGGCTCTCTAAATTCTATTGGCGATGGACCAGGCAAATATCAT
GCTATTAATGTACCTTTAAGACCAGGAATCAATGATGAAACATTTGAACAAGTATTTAAG
GATGTTATGAAAAAAGTAATGGAAGTATATAGACCTAATGTAATATTGCTATAATGCGGA
GCTGATTCATTAGCATATGATAAGGTAAAATTAATTATTGTTAGAGTATTTATTTTTAAA
TAATGATTGATTATTGTTAAAAAAGCTAGGACACTTCAATTTATCAACAAAAGGGCATGG
AAAAGCTGTAGAATATATGAAAAGCTTTGGTATTCCTCTAATATTAATGGGAGGTGGTGG
TTATAATGTACCAAATGTTGCAAGATGCTGGGCTTATGAGACATCTATTTGTGTTGGAAA
TAAAATTGATGGAAATATTCCTATTACTGAGCCGTTTTATGACTATTTTGGTCCAGATCA
TAAACTCCATGTTACTCCTAAAAATAATGTGGATAATAAAAATACCAAGGATGAGCTCCA
TTAGAAGGTTTCAACCGTTCATGAATATTTAAGATAAATAGAAAGTGCACCTTCTATGGC
ATTCCATCACACCCCTGATAATAGTAAATTTGCAGAAGAAGAATAAAATATAGATGAAGA
ATTTGATTATGATATGGATGATGAAGAGTTAGAAAGATATTTTAAATAGAAAGAAAAACC
TATTATAATGAATAATAGATATATTTGA