Identifiers and Description

Gene Model Identifier

TTHERM_00395710

Standard Name

THD5 (Tetrahymena histone deacetylase 5)

Aliases

PreTt23595 | 42.m00329 | 3813.m01547

Description

Histone deacetylase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00395710

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11546.19.997093137033517e-262histone deacetylase (682 aa)
OxytrichaContig549.1.g141.9999366565375063e-113Histone deacetylase domain
WormBaseWBGene000079533.000074895537278e-78locus:hda-11 status:Partiall
y_confirmed UniProt:Q18477
protein_id:CAA94910.3
Stentor CoeruleusSteCoe_252286.813556821545298e-46
SGDYNL021W2.9992476920535046e-16HDA1 Putative catalytic subuni
t of a class II histone deacet
ylase complex that also contai
ns Hda2p and Hda3p; Hda1p inte
racts with the Hda2p-Hda3p sub
complex to form an active tetr
amer; deletion increases histo
ne H2B, H3 and H4 acetylation
DictyBaseDDB_G02680249.997764199084386e-16hdaA on chromosome: 1 position
1320084 to 1322172

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18178773: Smith JJ, Torigoe SE, Maxson J, Fish LC, Wiley EA (2008) A class II histone deacetylase acts on newly synthesized histones in Tetrahymena. Eukaryotic cell 7(3):471-82
  2. Ref:SUPR000095
  3. Ref:SUPR000086

Sequences

>TTHERM_00395710(coding)
ATGTACACACTAATTTGCGCTGTTTAAGATTTAGCTTTATTTGGAATTTTTATTACAGGG
TTGGTCTTATTAGAATGGCAAATAATTGTATTTCCCATTTTAATTTACATCCTCATCCCA
TTTTTAAACGAGTTGGTCTACAATTGCTTTGCTAAATTATTATTCACAATAGAAAAGGAG
AAGAAAAGGATGGAGTAAAGGTATTCTTAATCAGAATTAGAAAATAAATATATTGAAAAT
TTACCTATTTTATACCATCCCTCATACAACATTACAGCTTGTGGGATTGAAAAACTTCAC
CCTTTTGATTCTGTAAAGTATGGAAGAGTTTTTAATATACTCAAAGAAAAAGGATTTCTA
TAAGAATAAGGTTTCTATAAGCCAAAAGAAAAAGTAGGAAGAGGCTTAATGCTGCATTTA
GGAATGTCTCCTTTGTATTTACTTTATCTTAATTATGCTGCTTATGTATCCAAATGTATA
GAAATTCCTCTATTCTTCCTACCTGCCAGCTTCTTAAGATGGAAAGTATTAGATCCTATG
ATGTTTTCTACTCAGGGTTCAATAGATGCCGCCGTTTTATCTTTAAAAAGAGGCTGGTCT
ATAAATTTAAGTGGAGGCTATCACCACGCTTGCAGGTAATCTGGAGGCGGATTTTGCATA
TATCCAGACATATGTTTCGCTATAGAATATTTAAGAAAATGTTTTGGCATAAAAAGATGC
ATGATTGTAGATTTAGATGCTCATCAAGGAAATGGACATGAAAGAGATTTTATAGATGAT
AAAGAAAATACATTTATATTAGATTTTTACAATCACAGTATTTATCCAGCAGATACCTTT
GCAGCCAAAGGTATAAGTCTTTCTAAAAACGTAGATTTTGATACATCTGATTCAGAATAT
ATCTCTATGTTGAGAAAGACACTTTAAAAAATTCTTGATTAATTCAAACCTGAGTTTTTA
CTATATAATGCAGGAACTGATTGTCTTGAAGGTGATCGTTTGGGTTAAATGAATCTCTCT
CAAAATTGCATAATTCAGAGAGATTAAGTTGTATTTGAAGAATGCTTAAATAGAGATATA
CCCTTAACTATGGTGCTTTCAGGAGGGTATTAGTAAATAAATGCACCTGTTATAGCTGAC
TCTATTTTAAATCTTGATTAAAATTTAAAAATAAAAAATTACAATAGAAAAAAATTATAA
AACCCATGA


>TTHERM_00395710(protein)
MYTLICAVQDLALFGIFITGLVLLEWQIIVFPILIYILIPFLNELVYNCFAKLLFTIEKE
KKRMEQRYSQSELENKYIENLPILYHPSYNITACGIEKLHPFDSVKYGRVFNILKEKGFL
QEQGFYKPKEKVGRGLMLHLGMSPLYLLYLNYAAYVSKCIEIPLFFLPASFLRWKVLDPM
MFSTQGSIDAAVLSLKRGWSINLSGGYHHACRQSGGGFCIYPDICFAIEYLRKCFGIKRC
MIVDLDAHQGNGHERDFIDDKENTFILDFYNHSIYPADTFAAKGISLSKNVDFDTSDSEY
ISMLRKTLQKILDQFKPEFLLYNAGTDCLEGDRLGQMNLSQNCIIQRDQVVFEECLNRDI
PLTMVLSGGYQQINAPVIADSILNLDQNLKIKNYNRKKLQNP


>TTHERM_00395710(gene)
AAATTATTGAGCCAACCAAAAAATAAATAAGTTATAACAAAAGAGTCATAAATTAATTTA
TAACAAAAATTATGTACACACTAATTTGCGCTGTTTAAGATTTAGCTTTATTTGGAATTT
TTATTACAGGGTTGGTCTTATTAGAATGGCAAATAATTGTATTTCCCATTTTAATTTACA
TCCTCATCCCATTTTTAAACGAGTTGGTCTACAATTGCTTTGCTAAATTATTATTCACAA
TAGAAAAGGAGAAGAAAAGGATGGAGTAAAGGTATTCTTAATCAGAATTAGAAAATAAAT
ATATTGAAAATTTACCTATTTTATACCATCCCTCATACAACATTACAGCTTGTGGGATTG
AAAAACTTCACCCTTTTGATTCTGTAAAGTATGGAAGAGTTTTTAATATACTCAAAGAAA
AAGGATTTCTATAAGAATAAGGTTTCTATAAGCCAAAAGAAAAAGTAGGAAGAGGCTTAA
TGCTGCATTTAGGAATGTCTCCTTTGTATTTACTTTATCTTAATTATGCTGCTTATGTAT
CCAAATGTATAGAAATTCCTCTATTCTTCCTACCTGCCAGCTTCTTAAGATGGAAAGTAT
TAGATCCTATGATGTTTTCTACTCAGGGTTCAATAGATGCCGCCGTTTTATCTTTAAAAA
GAGGCTGGTCTATAAATTTAAGTGGAGGCTATCACCACGCTTGCAGGTAAACTAAAAGTT
TATAAAAAATATTAACATACTATTACAAATTTTTGAATAAAATAACAAAATTACATCTAA
TTATTATGTTTTTTAACTAAAAATAAATTTCATTTCTGCATCTTTTAACAATTTAAACAT
CTAAGATACTCTGAAAAGCAGAAAGTTGCCCTAGAAAATTAAAAAATTTACTCAAAATTT
TAAATAAATAATTTCAGTAGTGAATTAAGAAACCAATAAAAGCCTAATCAGTATTTATCA
ATAAAATTATAAACATCTAATAAAATCTAACATAGCATCAATAGGAATAAAAAGTAACTA
GTATAGAAATGATTAAATTATAGAGTAAATTTTAAAAAAATAATATAGAAGTATAAAACA
GGATTTAATTATTAATACAACATTCACCCAATTTATCATCTCCAAAAAATAGTTATTTAT
TTATTTAATTTTGATTAGAATAAGTTTTGAAATTCTTTTTTCTTTTATTTAATTTAAATT
CGATGTTTATCGTTTCATTTTATTAAAATTTAGGTAATCTGGAGGCGGATTTTGCATATA
TCCAGACATATGTTTCGCTATAGAATATTTAAGAAAATGTTTTGGCATAAAAAGATGCAT
GATTGTAGATTTAGATGCTCATCAAGGAAATGGACATGAAAGAGATTTTATAGATGATAA
AGAAAATACATTTATATTAGATTTTTACAATCACAGTATTTATCCAGCAGATACCTTTGC
AGCCAAAGGTATAAGTCTTTCTAAAAACGTAGATTTTGATACATCTGATTCAGAATATAT
CTCTATGTTGAGAAAGACACTTTAAAAAATTCTTGATTAATTCAAACCTGAGTTTTTACT
ATATAATGCAGGAACTGATTGTCTTGAAGGTGATCGTTTGGGTTAAATGAATCTCTCTCA
AAATTGCATAATTCAGAGAGATTAAGTTGTATTTGAAGAATGCTTAAATAGAGATATACC
CTTAACTATGGTGCTTTCAGGAGGGTATTAGTAAATAAATGCACCTGTTATAGCTGACTC
TATTTTAAATCTTGATTAAAATTTAAAAATAAAAAATTACAATAGAAAAAAATTATAAAA
CCCATGAAAAAAAGTTATTGATAGATTTATTTTTAAATAAAAAAAATCAGTAGACTGATA
AATGCTTAATCATCAATCTTTCACAAAATTTTAAAACTTTTTAAAAAATTATTATAATAA
TAATCTCAAATTCACAAATTGTATATCAAAAACAAAAAAAAATAACATATTCAAAAATGA
TATGACTTAACTTTTTATTTTTCAATTTATATATATATAACCTATTACTTTATTAAACTA
AGTATTTACTAGCTATTCATTTTCTAGTCTTTTTAACAATAACTATTAGC