Identifiers and Description

Gene Model Identifier

TTHERM_00395710

Standard Name

THD5 (Tetrahymena Histone Deacetylase 5)

Aliases

PreTt23595 | 42.m00329 | 3813.m01547

Description

Histone deacetylase family protein; suppresses DNA transcription by deacetylation of histones; localizes to macronucleus

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 19.5%

TetraMine Data

TTHERM_00395710

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11546.19.997093137033517e-262histone deacetylase (682 aa)
OxytrichaContig549.1.g141.9999366565375063e-113Histone deacetylase domain
WormBaseWBGene000079533.000074895537278e-78locus:hda-11 status:Partiall
y_confirmed UniProt:Q18477
protein_id:CAA94910.3
Stentor CoeruleusSteCoe_252286.813556821545298e-46
SGDYNL021W2.9992476920535046e-16HDA1 Putative catalytic subuni
t of a class II histone deacet
ylase complex that also contai
ns Hda2p and Hda3p; Hda1p inte
racts with the Hda2p-Hda3p sub
complex to form an active tetr
amer; deletion increases histo
ne H2B, H3 and H4 acetylation
DictyBaseDDB_G02680249.997764199084386e-16hdaA on chromosome: 1 position
1320084 to 1322172

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18178773: Smith JJ, Torigoe SE, Maxson J, Fish LC, Wiley EA (2008) A class II histone deacetylase acts on newly synthesized histones in Tetrahymena. Eukaryotic cell 7(3):471-82
  2. Ref:SUPR000095
  3. Ref:SUPR000086

Sequences

>TTHERM_00395710(coding)
ATGTACACACTAATTTGCGCTGTTTAAGATTTAGCTTTATTTGGAATTTTTATTACAGGG
TTGGTCTTATTAGAATGGCAAATAATTGTATTTCCCATTTTAATTTACATCCTCATCCCA
TTTTTAAACGAGTTGGTCTACAATTGCTTTGCTAAATTATTATTCACAATAGAAAAGGAG
AAGAAAAGGATGGAGTAAAGGTATTCTTAATCAGAATTAGAAAATAAATATATTGAAAAT
TTACCTATTTTATACCATCCCTCATACAACATTACAGCTTGTGGGATTGAAAAACTTCAC
CCTTTTGATTCTGTAAAGTATGGAAGAGTTTTTAATATACTCAAAGAAAAAGGATTTCTA
TAAGAATAAGGTTTCTATAAGCCAAAAGAAAAAGTAGGAAGAGGCTTAATGCTGCATTTA
GGAATGTCTCCTTTGTATTTACTTTATCTTAATTATGCTGCTTATGTATCCAAATGTATA
GAAATTCCTCTATTCTTCCTACCTGCCAGCTTCTTAAGATGGAAAGTATTAGATCCTATG
ATGTTTTCTACTCAGGGTTCAATAGATGCCGCCGTTTTATCTTTAAAAAGAGGCTGGTCT
ATAAATTTAAGTGGAGGCTATCACCACGCTTGCAGGTAATCTGGAGGCGGATTTTGCATA
TATCCAGACATATGTTTCGCTATAGAATATTTAAGAAAATGTTTTGGCATAAAAAGATGC
ATGATTGTAGATTTAGATGCTCATCAAGGAAATGGACATGAAAGAGATTTTATAGATGAT
AAAGAAAATACATTTATATTAGATTTTTACAATCACAGTATTTATCCAGCAGATACCTTT
GCAGCCAAAGGTATAAGTCTTTCTAAAAACGTAGATTTTGATACATCTGATTCAGAATAT
ATCTCTATGTTGAGAAAGACACTTTAAAAAATTCTTGATTAATTCAAACCTGAGTTTTTA
CTATATAATGCAGGAACTGATTGTCTTGAAGGTGATCGTTTGGGTTAAATGAATCTCTCT
CAAAATTGCATAATTCAGAGAGATTAAGTTGTATTTGAAGAATGCTTAAATAGAGATATA
CCCTTAACTATGGTGCTTTCAGGAGGGTATTAGTAAATAAATGCACCTGTTATAGCTGAC
TCTATTTTAAATCTTGATTAAAATTTAAAAATAAAAAATTACAATAGAAAAAAATTATAA
AACCCATGA


>TTHERM_00395710(protein)
MYTLICAVQDLALFGIFITGLVLLEWQIIVFPILIYILIPFLNELVYNCFAKLLFTIEKE
KKRMEQRYSQSELENKYIENLPILYHPSYNITACGIEKLHPFDSVKYGRVFNILKEKGFL
QEQGFYKPKEKVGRGLMLHLGMSPLYLLYLNYAAYVSKCIEIPLFFLPASFLRWKVLDPM
MFSTQGSIDAAVLSLKRGWSINLSGGYHHACRQSGGGFCIYPDICFAIEYLRKCFGIKRC
MIVDLDAHQGNGHERDFIDDKENTFILDFYNHSIYPADTFAAKGISLSKNVDFDTSDSEY
ISMLRKTLQKILDQFKPEFLLYNAGTDCLEGDRLGQMNLSQNCIIQRDQVVFEECLNRDI
PLTMVLSGGYQQINAPVIADSILNLDQNLKIKNYNRKKLQNP


>TTHERM_00395710(gene)
AAATTATTGAGCCAACCAAAAAATAAATAAGTTATAACAAAAGAGTCATAAATTAATTTA
TAACAAAAATTATGTACACACTAATTTGCGCTGTTTAAGATTTAGCTTTATTTGGAATTT
TTATTACAGGGTTGGTCTTATTAGAATGGCAAATAATTGTATTTCCCATTTTAATTTACA
TCCTCATCCCATTTTTAAACGAGTTGGTCTACAATTGCTTTGCTAAATTATTATTCACAA
TAGAAAAGGAGAAGAAAAGGATGGAGTAAAGGTATTCTTAATCAGAATTAGAAAATAAAT
ATATTGAAAATTTACCTATTTTATACCATCCCTCATACAACATTACAGCTTGTGGGATTG
AAAAACTTCACCCTTTTGATTCTGTAAAGTATGGAAGAGTTTTTAATATACTCAAAGAAA
AAGGATTTCTATAAGAATAAGGTTTCTATAAGCCAAAAGAAAAAGTAGGAAGAGGCTTAA
TGCTGCATTTAGGAATGTCTCCTTTGTATTTACTTTATCTTAATTATGCTGCTTATGTAT
CCAAATGTATAGAAATTCCTCTATTCTTCCTACCTGCCAGCTTCTTAAGATGGAAAGTAT
TAGATCCTATGATGTTTTCTACTCAGGGTTCAATAGATGCCGCCGTTTTATCTTTAAAAA
GAGGCTGGTCTATAAATTTAAGTGGAGGCTATCACCACGCTTGCAGGTAAACTAAAAGTT
TATAAAAAATATTAACATACTATTACAAATTTTTGAATAAAATAACAAAATTACATCTAA
TTATTATGTTTTTTAACTAAAAATAAATTTCATTTCTGCATCTTTTAACAATTTAAACAT
CTAAGATACTCTGAAAAGCAGAAAGTTGCCCTAGAAAATTAAAAAATTTACTCAAAATTT
TAAATAAATAATTTCAGTAGTGAATTAAGAAACCAATAAAAGCCTAATCAGTATTTATCA
ATAAAATTATAAACATCTAATAAAATCTAACATAGCATCAATAGGAATAAAAAGTAACTA
GTATAGAAATGATTAAATTATAGAGTAAATTTTAAAAAAATAATATAGAAGTATAAAACA
GGATTTAATTATTAATACAACATTCACCCAATTTATCATCTCCAAAAAATAGTTATTTAT
TTATTTAATTTTGATTAGAATAAGTTTTGAAATTCTTTTTTCTTTTATTTAATTTAAATT
CGATGTTTATCGTTTCATTTTATTAAAATTTAGGTAATCTGGAGGCGGATTTTGCATATA
TCCAGACATATGTTTCGCTATAGAATATTTAAGAAAATGTTTTGGCATAAAAAGATGCAT
GATTGTAGATTTAGATGCTCATCAAGGAAATGGACATGAAAGAGATTTTATAGATGATAA
AGAAAATACATTTATATTAGATTTTTACAATCACAGTATTTATCCAGCAGATACCTTTGC
AGCCAAAGGTATAAGTCTTTCTAAAAACGTAGATTTTGATACATCTGATTCAGAATATAT
CTCTATGTTGAGAAAGACACTTTAAAAAATTCTTGATTAATTCAAACCTGAGTTTTTACT
ATATAATGCAGGAACTGATTGTCTTGAAGGTGATCGTTTGGGTTAAATGAATCTCTCTCA
AAATTGCATAATTCAGAGAGATTAAGTTGTATTTGAAGAATGCTTAAATAGAGATATACC
CTTAACTATGGTGCTTTCAGGAGGGTATTAGTAAATAAATGCACCTGTTATAGCTGACTC
TATTTTAAATCTTGATTAAAATTTAAAAATAAAAAATTACAATAGAAAAAAATTATAAAA
CCCATGAAAAAAAGTTATTGATAGATTTATTTTTAAATAAAAAAAATCAGTAGACTGATA
AATGCTTAATCATCAATCTTTCACAAAATTTTAAAACTTTTTAAAAAATTATTATAATAA
TAATCTCAAATTCACAAATTGTATATCAAAAACAAAAAAAAATAACATATTCAAAAATGA
TATGACTTAACTTTTTATTTTTCAATTTATATATATATAACCTATTACTTTATTAAACTA
AGTATTTACTAGCTATTCATTTTCTAGTCTTTTTAACAATAACTATTAGC