Identifiers and Description

Gene Model Identifier

TTHERM_00663840

Standard Name

THD3 (Tetrahymena histone deacetylase 3)

Aliases

PreTt23831 | 98.m00174 | 3736.m00072 | THD3

Description

Histone deacetylase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00850 ) Histone deacetylase family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00663840

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17202.19.997093137033517e-262histone deacetylase (473 aa)
DictyBaseDDB_G02680242.000851114308011e-136hdaA on chromosome: 1 position
1320084 to 1322172
WormBaseWBGene000018342.9988601762256104e-132locus:hda-1 Histone deacetyl
ase 1 status:Confirmed Uni
Prot:O17695 protein_id:CAB03
984.1
SGDYNL330C3.999751664085691e-132RPD3 Histone deacetylase; regu
lates transcription, silencing
, and other processes by influ
encing chromatin remodeling; f
orms at least two different co
mplexes which have distinct fu
nctions and members
OxytrichaContig1866.0.g685.0014192254601655e-126Histone deacetylase domain
Stentor CoeruleusSteCoe_315541.1677812485237086e-60

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18178773: Smith JJ, Torigoe SE, Maxson J, Fish LC, Wiley EA (2008) A class II histone deacetylase acts on newly synthesized histones in Tetrahymena. Eukaryotic cell 7(3):471-82
  2. Ref:SUPR000083

Sequences

>TTHERM_00663840(coding)
ATGGAAACAAAAAAAAGAGTAGCTTATTTTTACAATAACGAAATAGGTAACTACAACTAT
GGAAAGTTGCATTTAATGAACCCAAAAAGAATTTCAATGACTCATTCCTTGATTGTAGGT
TATGGTGTCTATAAAGATCTTGACGTATACACAACAAGAGAAGCCACCAAAGAAGAGATA
ATGCAGTTTCATGATTAGGATTATGTTGAGTACCTTTCTAACTATGTATCGAGTACTAAA
ATAGATTTTCTAAGAAAGAATGGATGCACTGCTCCTATCATAGATGAGGAAGCTAAAAAT
GATGTAGAAAAAAAGAGATAATATGGCATAGATGTTCAAGCTGATTGTCCTGGCTTTGAT
GGTGTCTATACCTTTAGCCAACTTTCAACAGGTGGTTCGATTGATGCAGCTCACTTAATT
ATAAATAATGCTGCAGATGTAGCTATTAACTGGGGTGGTGGATTGCATCATGCTAAGAAG
GGAGAAGCTTATGGCTTCTGTTATGTTAATGATATAGTAATATGCATTTTGGAGCTTTTA
AAAGTATTTCCTCGTGTGCTTTACATAGATATAGATGTACACCATGGAGATGGCGTAGAA
GAGGCTTTCTTTACTACAAATAGAGTAATGACAGTTAGTTTTCATGAATTTGGAGAAGAT
TTCTTTCCTGGAACAGGTGGCCTCAACAGTAGTGGAGAAGGATTGGGCAAAAATTATGCT
GTGAATGTACCACTTAGACCTGGTATGGATGATGAAAGTTATAAATAACTATTTAAAAAT
GTAATGAATAAAGTAATGGAAGTGTTTAGACCTGACGTAGTTGTATTCTAAACTGGAGCT
GATAGTTTAGCTAATGACAAAATTGGGCATTTTAATTTATCTATTAGAGGACATGGCGAA
TGCTTGACTTACATGCTAAGGTTTAATGTTCCTGTAGTAGTTTTAGGAGGAGGTGGATAT
ACTATTTAAAATGTAAGTCGTTGCTGGGCATATGAAACAGGATTACTTGTTAAAAAAAAT
TTAAATGGACCTATACCTGTTGATGATCCCTTTTTCCATTTATATGAAAAATAGAATATG
CTTCACGTTCCAATTTAGCAAGTAGAAAATAAGAATAGTAAAGAAGATTTAAATAAAATA
TAAGAAGAGGTCTTTAAGCAACTAAAAGAAGTAGATGCTGCCCCATCAATACCTTTTCAT
AATGTTCCCAAAGCATTCTAGTATGATGACGATGAATATTTCGAGGAAAATGAATAAGAT
TAACATCATGATTTTTCTGGAAATACTTATAATTTCAATAAGCTTAATGACTATATAAAC
GGATATTAAACAATGGAGGTCGAATAAAATGAAGAAGTTGGAGTATATAGAAAACAACCT
CTATTAATAGAAAAGAATAGTAGTAGATTTAATCATATTTGA


>TTHERM_00663840(protein)
METKKRVAYFYNNEIGNYNYGKLHLMNPKRISMTHSLIVGYGVYKDLDVYTTREATKEEI
MQFHDQDYVEYLSNYVSSTKIDFLRKNGCTAPIIDEEAKNDVEKKRQYGIDVQADCPGFD
GVYTFSQLSTGGSIDAAHLIINNAADVAINWGGGLHHAKKGEAYGFCYVNDIVICILELL
KVFPRVLYIDIDVHHGDGVEEAFFTTNRVMTVSFHEFGEDFFPGTGGLNSSGEGLGKNYA
VNVPLRPGMDDESYKQLFKNVMNKVMEVFRPDVVVFQTGADSLANDKIGHFNLSIRGHGE
CLTYMLRFNVPVVVLGGGGYTIQNVSRCWAYETGLLVKKNLNGPIPVDDPFFHLYEKQNM
LHVPIQQVENKNSKEDLNKIQEEVFKQLKEVDAAPSIPFHNVPKAFQYDDDEYFEENEQD
QHHDFSGNTYNFNKLNDYINGYQTMEVEQNEEVGVYRKQPLLIEKNSSRFNHI


>TTHERM_00663840(gene)
ATGGAAACAAAAAAAAGAGTAGCTTATTTTTACAATAACGAAATAGGTAACTACAACTAT
GGAAAGTTGCATTTAATGAACCCAAAAAGAATTTCAATGACTCATTCCTTGATTGTAGGT
TATGGTGTCTATAAAGATCTTGACGTATACACAACAAGAGAAGCCACCAAAGAAGAGATA
ATGCAGTTTCATGATTAGGATTATGTTGAGTACCTTTCTAACTATGTATCGAGTACTAAA
ATAGATTTTCTAAGAAAGAATGGATGCACTGCTCCTATCATAGATGAGGAAGCTAAAAAT
GATGTAGAAAAAAAGAGATAATATGGCATAGATGTTCAAGCTGATTGTCCTGGCTTTGAT
GGTGTCTATACCTTTAGCCAACTTTCAACAGGTAATAAATTATATTTCCATTTTGAACAA
GAATTTGAGTTAGTTGGATTTACAGTTTTCAAAATATATACTAGAAAAAATTTACTTGCT
TAAATCTTCTCCTTCTATTTAAAGAATTTGAGTAGAAGAAAGTAATAAATATTCAATAAA
TAATTAATTATTATCCTAGAAAATGGTGAAAAATAATAGTTAAACACAATTTCAAAAAAA
ATTATTTTTAACCCAAATTTATATTTTAAAATATTTAAAAAATATTCATTTTAGTAAAAA
TAAAATTTAAATTTAATATCTTAATATTTTTTTTCTTTAAACCATAATTAGGTGGTTCGA
TTGATGCAGCTCACTTAATTATAAATAATGCTGCAGATGTAGCTATTAACTGGGGTGGTG
GATTGCATCATGCTAAGAAGGGAGAAGCTTATGGCTTCTGTTATGTTAATGATATAGTAA
TATGCATTTTGGAGCTTTTAAAAGTATTTCCTCGTGTGCTTTACATAGATATAGATGTAC
ACCATGGAGATGGCGTAGAAGAGGCTTTCTTTACTACAAATAGAGTAATGACAGTTAGTT
TTCATGAATTTGGAGAAGATTTCTTTCCTGGAACAGGTGGCCTCAACAGTAGTGGAGAAG
GATTGGGCAAAAATTATGCTGTGAATGTACCACTTAGACCTGGTATGGATGATGAAAGTT
ATAAATAACTATTTAAAAATGTAATGAATAAAGTAATGGAAGTGTTTAGACCTGACGTAG
TTGTATTCTAAACTGGAGCTGATAGTTTAGCTAATGACAAAATTGGGCATTTTAATTTAT
CTATTAGAGGACATGGCGAATGCTTGACTTACATGCTAAGGTTTAATGTTCCTGTAGTAG
TTTTAGGAGGAGGTGGATATACTATTTAAAATGTAAGTCGTTGCTGGGCATATGAAACAG
GATTACTTGTTAAAAAAAATTTAAATGGACCTATACCTGTTGATGATCCCTTTTTCCATT
TATATGAAAAATAGAATATGCTTCACGTTCCAATTTAGCAAGTAGAAAATAAGAATAGTA
AAGAAGATTTAAATAAAATATAAGAAGAGGTCTTTAAGCAACTAAAAGAAGTAGATGCTG
CCCCATCAATACCTTTTCATAATGTTCCCAAAGCATTCTAGTATGATGACGATGAATATT
TCGAGGAAAATGAATAAGATTAACATCATGATTTTTCTGGAAATACTTATAATTTCAATA
AGCTTAATGACTATATAAACGGATATTAAACAATGGAGGTCGAATAAAATGAAGAAGTTG
GAGTATATAGAAAACAACCTCTATTAATAGAAAAGAATAGTAGTAGATTTAATCATATTT
GA