Identifiers and Description

Gene Model Identifier

TTHERM_00621610

Standard Name

THD2 (Tetrahymena Histone Deacetylase 2)

Aliases

PreTt05158 | 86.m00190

Description

THD2 histone deacetylase family protein; Histone deacetylase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 72.7%

TetraMine Data

TTHERM_00621610

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03031.19.997093137033517e-262hypothetical protein (1599 aa)
Stentor CoeruleusSteCoe_81258.074506789675094e-73
OxytrichaContig12864.0.g70.00010003404299092957hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18178773: Smith JJ, Torigoe SE, Maxson J, Fish LC, Wiley EA (2008) A class II histone deacetylase acts on newly synthesized histones in Tetrahymena. Eukaryotic cell 7(3):471-82
  2. Ref:SUPR000079
  3. Ref:SUPR000080

Sequences

>TTHERM_00621610(coding)
ATGTAATAACTTATTTTTCTGTTAGCTACAATCTACTAAATATTAAGAACTACATAGGCA
GGTACAATTACTCCAACAACGCAACCACCTCCGATTTATAATACATTGGCTAATGCGGGA
GTTAGAGCTGACTACACTTTTTCTTTCATTCCACAAACATTTTTACCTGCAGGAGGAAAC
TTATAAATTATATTTCCTTCTCAATATAGTGCTACATAGGCTTTTTAGATAAATAATTTA
GTGTGCAGTGTTACTTGTTAAGCTAGCGGATTAACTCTAACTTTCACATTTCCTTATGAT
CTTGCAGCAGGAATAGCCCAAACTGTTACTGTTTAGCAAGTTTTAAATCCTTCCACTAAA
GGTGGAGTAGGAAGTTTTATACTCCAAACATTATAAGGATAGAATATCGTAGATTAGAAT
AAAATTTTTGGAATTATTGGAATAGCTGATATCTCAACAAATCTAATTTCTGCTAACATT
TAGGTTAATCCTTCAGGTAGTGATCTAGCTGGAGACTACACTTCATATTAGCTCACCTTT
TAAACAGCTAGTAACATACCTGCAGGAAGTTATTTTATCCTATAGATCCCAACAGATTTT
ACCTTAGAAGACTATCCTACATGCATATCACCAAGTTTAAATGGTTACTTTATAGCTGGT
CAGCTTATATGCACTTTATAAAGTAATAATTAGGTTAGAATAGATGGAGTAGTAGGAGTT
CTCACCTAAGGTATCAATTATGTCTTATAAATTTCAATGCAAAATCCTCCATACACTATT
AATCCTAACACAGCTAGTAGTAACTATGTCTTCTCTTTCTAAATTTACAAACAAGGAACT
CAAATATTATTTGAAAGTATCTCTGGCATTTAGGGTCCTGCAATCAATGCTGCTGGATTA
AATAATATCTCTTTAACTCCTACAGATTAATTAAACTTAAATAACAGATATATCTATGCC
GAATACAAGCTAAACTTTACACCAACTCTGGCGCTTGAAAATGGAAATTGTATAGTAATA
TCATTCCCTGCTTATTTTTAGGTATTAGTAAGTTAGTAATTAATGTACTTGTAGGAAAAT
ATGTATTAATTGCATTATATAAATTATGGACTTGATAATTTATCAGAAAATAATAAAGTT
TAAATCTCAGTCAGTTCAAATTCTATTATCATTTCGAACTTTGCTACACAGCAGTTCATT
TAAGAAATATCAGTTATTATCATGACAAGAAACCCAGATGCAGCTGGAACAGCTACTCCA
TTGAAGATATACATATACCAAGATACTACCTAGTCTACTTTAATAGCATAAGATGTGAAT
TCTGCTACTGCTAATATAGATCCTTATACATCATGTGACCATTCAACTGATTAGATTTTA
GCAAGTATCAACTACTATCTATGGAATAATGCTTGGCCTAAGGCAACTTAAACTCCAGTT
GTAATTCCTTCAATTTAATTTGAGTTTAAACCTTTGAAAACTATTCCTATTGGAGGGTTA
ATCAAAATAGCAATTCCTAAAGAATTCACCTTTAATCCTGCATTTCCTACAACTGCGACT
GACTGTGGTATTTATTATGGATATTCTTAGTTTACCATGACTGCAGGAAATACCCCTTAA
TTTAATAACATATATCCTTCATAAAGATAAAGATCTACTCTCTTTTAAACTTATCAGCCT
GTTGGAACTGCTGGTTCTAATTCTTTTGCATGCTAAACTTCAATTACAGGAAATATAATG
ACAATATCTGGCATTCAGAATACACTTTTTGGGAACCAGGGACTCATTCATATATTGGTA
TTAAAAAATTGGGTTATGACTCCAGCAAGAAATGCAACTTACTTTTTTGCCTTAACGTCT
TATGACAGTGACAAATATACAATCTTAGAGTCATGGAAAGATGCATTTTAAATAAACCCA
AAAGATCTTACAACAACTCCAGTAGTCAATCTGATAAATAATTACGTTTCTAGTGTAGCT
ACTATCTCAAAATCTATATTAGATATTTAATTAACAACAGACATAACTATCCCTAGTGGC
TAACCAATATATAAATCAACTGATACTTAAGGATTTATTTAATTAGATTTTAGGTAATTA
TCAGGTGGTGATGCATGGTAGCTTGGACTTGGTCTTAATGTACCCAGTGGGACATAAATA
CCATGTAGAGGTATTTAAGGAATCATACCCATTTAAGGATCATCAATTATTTGTACTTAT
GTATAGGCATCATACACTGCTTTAACCACTACTACATTTTCTTAGATCTTCATAAAAAAT
TTTGTACAAATTCCAGCAAACACTTTAGTTAGAATTCATATTCCTAACCTTCTTAATCCT
TAAGGAGGTGGAACTACTTCTGATTTATCAATAAGACTTGTTTCAAACACAAATAATGTT
TATTAATATTTAGCTTAAAAATCGATTTTAATTACAGATAAACCTATTGGTACTTTTGTT
GTTTAAAATGTATTGAATCTCAGCTATTCAACTAATTATGTGGGATAAACATTCAATTTA
GGTTTTAATACAAAAACCTCACCCTCTGCAGGAGATTTACTCCTTATTTAGCTACCAACG
TTCTCAAACGGTTTCATAGTTCAAGACTAAACTATCTCATGCTCAGTAAACTCTATCAAT
ATGTATTGCATTCCATACTATTAAGCTGATATGATCTTAATTATGATTTCTTAAAATTTT
GCATCACCATAATAATCAATTTTGATATCAAATATAAACTGGCCTCAATATCAAAGTAAC
TTCGTTGCAACTTTTTCAACTCTCGATGTATATTGGACATCTTCGACAGGAGTTACAAAT
AAGGCTGAAAGAAATAACTAATTAATTAACAACCTTCCAAACTAATTTTCTAATGCATCG
ATTGTTATCCCTAAAAAAGGAATTCAATATGTAGATTGCTCTTACCAGTTTAGTTTCACT
GGTAATGCTGATATTCCAGCCTTGAGCTTGATATAAGTTATATTCCCCAATAATTACAAC
CTGTTAGGATCTACCCCACTGCCAACAGTGACATACTCAGGGTTGACTAGCTATAGTTCT
TCACAACAACTATCTATTTAAATAACAATTTAAATGATTACAATTTCAAATAATTAATAT
CTGCCAGCAGGTTCTACATTTACAGTAACAGTTTCAGGAGTTAAGAATCCTTCAACTATG
CCTGCTAATGGTCTATCTACTGGATGGGGAATTCAAGTAGTATAGTACGATGCTGTAAAT
GATATCAGTAATTTAGTTATGCAATAACTAAACTTTTACAGCTTCGCTTTTGATCCAGTT
TTCACACCTGGGACAATTGTTTTCAATTCAATTACAGCTTTTCCACTCAATGCTGACGAA
ACTGCAACTTATACTATTCAGTTCACTCCATATACTAACATACCTATTTAGGGTGTCATC
TAAATTACTTTTCCTTAAAATAATTTTAAATCTCTCCCCTCTCCTCCAAACTGTAGTATG
GGAGGAGCAGTTACAACTTTTAGTAGTTGTACTCTTAGTGGCTCTACTTTCTCAATTGTG
ATTTAAGATTAGTATAATTCTGGTAGTGGAAGTATCACTTTATCCATAACTAATATAAAA
AACCCAGATTAAGGTACTTCAGATGGCTTCATAATAGAAACAACTTACGACGGTCAGACT
TTAGATATTACAGATTAAACCACTTTGAGTAGTAGAACAATAACTACAGTCTAAAGAGCT
CCTGAAATTACTGTAAACTCTATTACCTTTAGTCCATAAAATATAAGCGAAAGAAGTACA
TACACCTTCTCATTTATTACAAGTGATATCATCACTTCTTAAATGTAAATTCTATTCTAG
TTCCCATCAGACTATGATAAGCTATTAGGAAAAAACGTTAAGTGTATTATAGTCTCTGGT
ATATTAGGTAATTTTTATAGTTGTTATGTGTAAAATGGCGGAGTTTATTTATAGAATTTT
GATTCTTATCAACCAAGTAGCTCAAATCCTATAGTTGTTCAGATATTTGGTGTAACAAAC
CCTAATATAGCTTATACTAATACTGGTTAGTTCTCGATATCATTGCTATATAAAGGGGAT
AACAAATTCATCAATTCATAATCTTAGGCAGGATAATTATAAATGTACGGAAATCCAGGA
TGGTTATCTGTTTAGACTGTAACAGCTAGTTAATTTAATGTGAGGTACACTGCTAGTTAT
TAATTTTCTTTTACTCTAAGTAAGAATGTTCCAAAGATTTTATCATAAGGAGCAATATTT
ATAGATTTTCCTCCTTAATTTGATTAAGTCTCAGACGGAAGAGGCTCTTGTACAACTACA
ACAGCTTCTTTCGCTTAGGTTATAGATTGTTACACCATTCAAAATCGTTACAATGTAACA
GGTAATACTCAAGATTTCTCTGGTTAGCTTTAGGTATCAATAGCGTCGGTTCTAAATCCT
ACTTTCTAAGGAATTACTGATAACTTTTATGTAAGTTCATTTGATGGCATAAACCAAATT
ATTATTGATAGAAGCTACATAAATTTAGATCCATTTTCATTTAGCTACGTTTATCCTGGT
CCACTGATTCACGTAAATAATGATTAAGGCATCTCACTCTACCCTGGTACATAAACTGTT
GATCTATATATTACACTAGATTTCCCTTCATTACTTGAGTTAAGTGTAAAGCCAAATATC
TTACCAGGTTTCAAAGTAATCCCATTCGACATTCCTATTCATCTAGGTTAGACATCCATC
CCTTTCAGAATATCCTGCCCATAATAAATATTTTCTGGTTCTTATACACTCTAATGGGTA
ACACTAGGAGATAATGTGCCTCCCATCTACACACCAATATAAACTTCTTAAATTACTATC
CTCAATCCTACAATTTAAACTGTGCTCATGAACTCTATCTTAGATATTCCTTATGGAGGA
ACTTCTTTAGACACAATACTTTCTGTGACTTATGCATCTGATATTTATTTTGAAGTCCAT
ATGAATTTAGCCTCTTAGTATCCAGGAATTTCATTAAGTACTTAAATGCTAAATTTCACC
AAAGGAATAAACTAGCTCAGTTTTAGAGTTATTTCTACTCCTACAAATAATACTAGTTCA
TCTGTTTCAAGAGGTTCTATAGTTTTCTCATTATTGGGAATAGATTCAACTATATTTTAA
CTACAATATACTTAAATGTACTTCAATTTAATAGCGGCTGATAACATAGCACCTCAAATT
ATTTAGCTTCAGACAGTTAATATATTAAAAAATAGTGTTTAAATTAACGTTATGACTAAT
GAACCAACTGTAGTTTACTATATGTGTAGTTTAAATGGAACATCATATCCAAGCTTCTCT
TAAGTTTTTAATAAAACTGCTCCTCCTGCCAATACTACTTAAAGCTAATATGGATAATTA
GTCTTAAATTAAGCTAATGCAAACTTTTACTTTAACATAACAAACCTCACTGCCCAAACT
CCTTATATCATCCATCTATTTTTCTAAGATAGAGGAAATAATGTTGCAAATAAGACTCTA
ACTTTTGTCACAAGCAATCGATATAATGCCGCAACATTTAGTCTGAGATTCTAAGTCCTT
TAACTATCAGCTACTGAAATCAAGAGCGTGCTTATTAATTTATCGAATATTTTAACTATT
GATTTGAATACCTTGTACATCTAGAAATATTATTTTAATAATACCTCCTCAAGTACTAGC
TCAAGTAGAATTCTGTAAAGCACACAATTAGCTGATTAAATAAACCAAATTTAAGAAACT
ACAGATAATCAAGGTAATTAAAAAAGATAAAAGGCTAATAGAATATTAGATGTTTCGACT
TCAATTTATACTTTACTGAACATCTAAATATCTTCAAATAGACTCGTAGAGTATTATCCT
TCGCCATTAACTTTAGCTAATTCTTTGAACAATAAAACTGTATTGCTGAAAGCTGCAATG
CCCACTTATGATAGCTCGTATTTAGTAATCCCAAACACATTTGTATCCTACTATCCTAAT
TTTATTTAGCCTCCTTAATTTTTGTCTAATGACTGGTCTACTGCTAATTTCACAGTCGTC
TTAGACTAACCAGGATTTGTTTATGTGACTGGAGAGTTATATGTCTCAAATACCTAGCCC
TCTCCTTATCCTGATTAAATTTATTGGGGTTATGACCATACAAACATTAAAGCACCTAGC
GGATATGTAGAAGTAAGCTAAGGATATACTTAATTTAACTTAACTCTACGTAACCTTAAA
CCAAATTCAAAGTATTTTGCTTACATAATTGGAGGAAGTGTCCAGCCTGGATACCCAGAT
TTAATGGACGCATCCAAAATAGTAAGAATTTAATTTACAACACTTCCTTCACCTTCAGAT
TTAGAACTAGATATAAATACTGGAACCAAATTAGAATTTAGCACTAAATTTCTAGTGCTA
CTATTTTTAATTATTTAAGTATTCATATGA


>TTHERM_00621610(protein)
MQQLIFLLATIYQILRTTQAGTITPTTQPPPIYNTLANAGVRADYTFSFIPQTFLPAGGN
LQIIFPSQYSATQAFQINNLVCSVTCQASGLTLTFTFPYDLAAGIAQTVTVQQVLNPSTK
GGVGSFILQTLQGQNIVDQNKIFGIIGIADISTNLISANIQVNPSGSDLAGDYTSYQLTF
QTASNIPAGSYFILQIPTDFTLEDYPTCISPSLNGYFIAGQLICTLQSNNQVRIDGVVGV
LTQGINYVLQISMQNPPYTINPNTASSNYVFSFQIYKQGTQILFESISGIQGPAINAAGL
NNISLTPTDQLNLNNRYIYAEYKLNFTPTLALENGNCIVISFPAYFQVLVSQQLMYLQEN
MYQLHYINYGLDNLSENNKVQISVSSNSIIISNFATQQFIQEISVIIMTRNPDAAGTATP
LKIYIYQDTTQSTLIAQDVNSATANIDPYTSCDHSTDQILASINYYLWNNAWPKATQTPV
VIPSIQFEFKPLKTIPIGGLIKIAIPKEFTFNPAFPTTATDCGIYYGYSQFTMTAGNTPQ
FNNIYPSQRQRSTLFQTYQPVGTAGSNSFACQTSITGNIMTISGIQNTLFGNQGLIHILV
LKNWVMTPARNATYFFALTSYDSDKYTILESWKDAFQINPKDLTTTPVVNLINNYVSSVA
TISKSILDIQLTTDITIPSGQPIYKSTDTQGFIQLDFRQLSGGDAWQLGLGLNVPSGTQI
PCRGIQGIIPIQGSSIICTYVQASYTALTTTTFSQIFIKNFVQIPANTLVRIHIPNLLNP
QGGGTTSDLSIRLVSNTNNVYQYLAQKSILITDKPIGTFVVQNVLNLSYSTNYVGQTFNL
GFNTKTSPSAGDLLLIQLPTFSNGFIVQDQTISCSVNSINMYCIPYYQADMILIMISQNF
ASPQQSILISNINWPQYQSNFVATFSTLDVYWTSSTGVTNKAERNNQLINNLPNQFSNAS
IVIPKKGIQYVDCSYQFSFTGNADIPALSLIQVIFPNNYNLLGSTPLPTVTYSGLTSYSS
SQQLSIQITIQMITISNNQYLPAGSTFTVTVSGVKNPSTMPANGLSTGWGIQVVQYDAVN
DISNLVMQQLNFYSFAFDPVFTPGTIVFNSITAFPLNADETATYTIQFTPYTNIPIQGVI
QITFPQNNFKSLPSPPNCSMGGAVTTFSSCTLSGSTFSIVIQDQYNSGSGSITLSITNIK
NPDQGTSDGFIIETTYDGQTLDITDQTTLSSRTITTVQRAPEITVNSITFSPQNISERST
YTFSFITSDIITSQMQILFQFPSDYDKLLGKNVKCIIVSGILGNFYSCYVQNGGVYLQNF
DSYQPSSSNPIVVQIFGVTNPNIAYTNTGQFSISLLYKGDNKFINSQSQAGQLQMYGNPG
WLSVQTVTASQFNVRYTASYQFSFTLSKNVPKILSQGAIFIDFPPQFDQVSDGRGSCTTT
TASFAQVIDCYTIQNRYNVTGNTQDFSGQLQVSIASVLNPTFQGITDNFYVSSFDGINQI
IIDRSYINLDPFSFSYVYPGPLIHVNNDQGISLYPGTQTVDLYITLDFPSLLELSVKPNI
LPGFKVIPFDIPIHLGQTSIPFRISCPQQIFSGSYTLQWVTLGDNVPPIYTPIQTSQITI
LNPTIQTVLMNSILDIPYGGTSLDTILSVTYASDIYFEVHMNLASQYPGISLSTQMLNFT
KGINQLSFRVISTPTNNTSSSVSRGSIVFSLLGIDSTIFQLQYTQMYFNLIAADNIAPQI
IQLQTVNILKNSVQINVMTNEPTVVYYMCSLNGTSYPSFSQVFNKTAPPANTTQSQYGQL
VLNQANANFYFNITNLTAQTPYIIHLFFQDRGNNVANKTLTFVTSNRYNAATFSLRFQVL
QLSATEIKSVLINLSNILTIDLNTLYIQKYYFNNTSSSTSSSRILQSTQLADQINQIQET
TDNQGNQKRQKANRILDVSTSIYTLLNIQISSNRLVEYYPSPLTLANSLNNKTVLLKAAM
PTYDSSYLVIPNTFVSYYPNFIQPPQFLSNDWSTANFTVVLDQPGFVYVTGELYVSNTQP
SPYPDQIYWGYDHTNIKAPSGYVEVSQGYTQFNLTLRNLKPNSKYFAYIIGGSVQPGYPD
LMDASKIVRIQFTTLPSPSDLELDINTGTKLEFSTKFLVLLFLIIQVFI


>TTHERM_00621610(gene)
ATGTAATAACTTATTTTTCTGTTAGCTACAATCTACTAAATATTAAGAACTACATAGGCA
GGTACAATTACTCCAACAACGCAACCACCTCCGATTTATAATACATTGGCTAATGCGGGA
GTTAGAGCTGACTACACTTTTTCTTTCATTCCACAAACATTTTTACCTGCAGGAGGAAAC
TTATAAATTATATTTCCTTCTCAATATAGTGCTACATAGGCTTTTTAGATAAATAATTTA
GTGTGCAGTGTTACTTGTTAAGCTAGCGGATTAACTCTAACTTTCACATTTCCTTATGAT
CTTGCAGCAGGAATAGGTATCCAATTTTTAATTTATATTTCCACATAAAATAATAACCAT
TAAATTCACAATAAGCTTAAAAATATTTCATTTTTTATAAAATATGTATTAATTATTTAT
ATTTTTTGTATAAATAAATTTTCTATTAGCCCAAACTGTTACTGTTTAGCAAGTTTTAAA
TCCTTCCACTAAAGGTGGAGTAGGAAGTTTTATACTCCAAACATTATAAGGATAGAATAT
CGTAGATTAGAATAAAATTTTTGGAATTATTGGAATAGCTGATATCTCAACAAATCTAAT
TTCTGCTAACATTTAGGTTAATCCTTCAGGTAGTGATCTAGCTGGAGACTACACTTCATA
TTAGCTCACCTTTTAAACAGCTAGTAACATACCTGCAGGAAGTTATTTTATCCTATAGAT
CCCAACAGATTTTACCTTAGAAGTAAACATAATATATTTTATATTTATATAAAGCAAAGT
CTATAAAGCATACATTAAAAAATATTTATAAAGACCTTTTGACTAGTTGATTGATTAATA
ATAGTTAAAGAGAAGATATTATTGAAATAAATAAATAAAATGAATTTAAATTATAAATGA
AATAATTAATAAATTATTTTTAAAATAGGACTATCCTACATGCATATCACCAAGTTTAAA
TGGTTACTTTATAGCTGGTCAGCTTATATGCACTTTATAAAGTAATAATTAGGTTAGAAT
AGATGGAGTAGTAGGAGTTCTCACCTAAGGTATCAATTATGTCTTATAAATTTCAATGCA
AAATCCTCCATACACTATTAATCCTAACACAGCTAGTAGTAACTATGTCTTCTCTTTCTA
AATTTACAAACAAGGAACTCAAATATTATTTGAAAGTATCTCTGGCATTTAGGGTCCTGC
AATCAATGCTGCTGGATTAAATAATATCTCTTTAACTCCTACAGATTAATTAAACTTAAA
TAACAGATATATCTATGCCGAATACAAGCTAAACTTTACACCAACTCTGGCGCTTGAAAA
TGGTAAATTAATTATAAATTAATCTATTTTCTAATGATAATATAAAATTTCAAGCAAATT
AGCTAGCTGTACCCACACATAGTCTATTAAAAAATTTACTTATTTACTCATTTTATTTAC
TTAATTTTGGTCAAATTTAAACTTTCAAAAAAACCAAAAATTTCTTTTTATTAATTATTG
AACTAGATTTGAATATTTATTTATTTATTATAAAAAATGAATAAAAACAACCTGCATTTG
TTTGTCAAAAGTCACAATTTACTCAAAATTTTTTTTGAATTTAAATAATAATAGGAAATT
GTATAGTAATATCATTCCCTGCTTATTTTTAGGTATTAGTAAGTTAGTAATTAATGTACT
TGTAGGAAAATATGTATTAATTGCATTATATAAATTATGGACTTGATAATTTATCAGAAA
ATAATAAAGTTTAAATCTCAGTCAGTTCAAATTCTATTATCATTTCGAACTTTGCTACAC
AGCAGTTCATTTAAGAAATATCAGTTATTATCATGACAAGAAACCCAGATGCAGCTGGAA
CAGCTACTCCATTGAAGATATACATATACCAAGATACTACCTAGTCTACTTTAATAGCAT
AAGATGTGAATTCTGCTACTGCTAATATAGATCCTTATAGTAACATATCATTTTTAATAT
TGTTGAAAATAATTTGGCTTTTTTAAAAAAAGCATCATGTGACCATTCAACTGATTAGAT
TTTAGCAAGTATCAACTACTATCTATGGAATAATGCTTGGCCTAAGGCAACTTAAACTCC
AGTTGTAATTCCTTCAATTTAATTTGAGTTTAAACCTTTGAAAACTATTCCTATTGGAGG
GTTAATCAAAATAGCAATTCCTAAAGAATTCACCTTTAATCCTGCATTTCGTAATTCATA
TTTTTCAATTTATAAAATTTATTAAATTCAAATAATTAAGAATACAAATAAATAATTACA
TTCATAAAAATTCTAATTTTATCAAAATTTATTAGATTTTTGTAATTTTAATTATATTTA
TTTTAATGCCAAAAGCTACAACTGCGACTGACTGTGGTATTTATTATGGATATTCTTAGT
TTACCATGACTGCAGGAAATACCCCTTAATTTAATAACATATATCCTTCATAAAGATAAA
GATCTACTCTCTTTTAAACTTATCAGCCTGTTGGAACTGCTGGTTCTAATTCTTTTGCAT
GCTAAACTTCAATTACAGGAAATATAATGACAATATCTGGCATTCAGAATACAGTAATTA
AACTAATCATATGATACTTTAAATTTATCATTTTTTTAATTTTAGCTTTTTGGGAACCAG
GGACTCATTCATATATTGGTATTAAAAAATTGGGTTATGACTCCAGCAAGAAATGCGTAT
GTTTATTTATTTATTTATTTGTTATATTAAAGCATAATTATTTTTAATTAGAACTTACTT
TTTTGCCTTAACGTCTTATGACAGTGACAAATATACAATCTTAGAGTCATGGAAAGATGC
ATTTTAAATAAACCCAAAAGATGTAAATTATAATAATATCAATACTATTTTTAAAACTTT
AATTAAATATATCTCAATTAAAGCTTACAACAACTCCAGTAGTCAATCTGATAAATAATT
ACGTTTCTAGTGTAGCTACTATCTCAAAATCTATATTAGATATTTAATTAACAACAGACA
TAACTATCCCTAGTGGCTAACCAATATATAAATCAACTGATACTTAAGGATTTATTTAAT
TAGATTTTAGGTAATTATCAGGTGGTGATGCATGGTAGCTTGGACTTGGTCTTAATGTAC
CCAGTGGGACATAAATACCATGTAGAGGTATTTAAGGAATCATACCCATTTAAGGATCAT
CAATTATTTGTACTTATGTATAGGCATCATACACTGCTTTAACCACTACTACATTTTCTT
AGATCTTCATAAAAAATTTTGTGTAATATTCAATTATTTATTTTATGAGTAAAGGATTTC
ATACTAAGTTAATTAATGCTCATATTTTGACAACATATTTAATTTCTTCCTTAATTAAAA
AAACCTAATTAAAAAACAAAATTAATATAATTAATAAAAATTAGACAAATTCCAGCAAAC
ACTTTAGTTAGAATTCATATTCCTAACCTTCTTAATCCTTAAGGAGGTGGAACTACTTCT
GATTTATCAATAAGACTTGTTTCAAACACAAATAATGTTTATTAATATTTAGCTTAAAAA
TCGATTTTAATTACAGATAAACGTAAAATTTTAATTTATATTTCTACTTAGTTTTTTTTA
TATTTTATTTTTTAAATATTTGAAAATTATTTTAGTATTTCCTCTCATTTAGGTTTATAA
AAATATTATTTATTTAATTATGAATTAGCTATTGGTACTTTTGTTGTTTAAAATGTATTG
AATCTCAGCTATTCAACTAATTATGTGGGATAAACATTCAATTTAGGTTTTAATACAAAA
ACCTCACCCTCTGCAGGAGATTTACTCCTTATTTAGCTACCAACGTTCTCAAACGGTTTC
ATAGTTCAAGACTAAACTATCTCATGCTCAGTAAACTCTATCAATATGTATTGCATTCCA
TACTATTAAGCTGATATGATCTTAATTATGATTTCTTAAAATTTTGCATCACCATAATAA
TCAATTTTGATATCAAATATAAACTGGCCTCAATATCAAAGTAACTTCGTTGCAACTTTT
TCAACTCTCGATGTATATTGGACATCTTCGACAGGAGTTACAAATAAGGCTGAAAGAAAT
AACTAATTAATTAACAACCTTCCAAACTAATTTTCTAATGCATCGATTGTTATCCCTAAA
AAAGTATTAAATTTAAATAAAAATAAAAATAAAATAAAATAAATTTTTTTTATTAATAGG
GAATTCAATATGTAGATTGCTCTTACCAGTTTAGTTTCACTGGTAATGCTGATATTCCAG
CCTTGAGCTTGATATAAGTTATATTCCCCAATAATTACAACCTGTTAGGATCTACCCCAC
TGCCAACAGTGACATACTCAGGGTTGACTAGCTATAGTTCTTCACAACAACTATCTATTT
AAATAACAATTTAAATGATTACAGTAGATTAATAAATGATTTAACATAAATTTTTTAAAA
TTAATATAAAAAATAGATTTCAAATAATTAATATCTGCCAGCAGGTTCTACATTTACAGT
AACAGTTTCAGGAGTTAAGAATCCTTCAACTATGCCTGCTAATGGTCTATCTACTGGATG
GGGAATTCAAGTAGTATAGTACGATGCTGTAAATGATATCAGTAATTTAGTTATGCAATA
ACTAAACTTTTACAGCTTCGCTTTTGATCCAGTTTTCACACCTGGGACAATTGTTTTCAA
TTCAATTACAGCTTTTCCACTCAATGCTGACGAAACTGCAACTTATACTATTCAGTTCAC
TCCATATACTAACATACCTATTTAGGGTGTCATCTAAATTACTTTTCCTTAAAATAATTT
TAAAGTATTTTAATTAAATTTACATTTCAATGATCAATCAATTTAATGTTTTTAAAAAAC
TAGTCTCTCCCCTCTCCTCCAAACTGTAGTATGGGAGGAGCAGTTACAACTTTTAGTAGT
TGTACTCTTAGTGGCTCTACTTTCTCAATTGTGATTTAAGATTAGTATAATTCTGGTAGT
GGAAGTATCACTTTATCCATAACTAATATAAAAAACCCAGATTAAGGTACTTCAGATGGC
TTCATAATAGAAACAACTTACGACGGTCAGACTTTAGATATTACAGATTAAACCACTTTG
AGTAGTAGAACAATAACTACAGTCTAAAGAGCTCCTGAAATTACTGTAAACTCTATTACC
TTTAGTCCATAAAATATAAGCGAAAGAAGTACATACACCTTCTCATTTATTACAAGTGAT
ATCATCACTTCTTAAATGTAAATTCTATTCTAGTTCCCATCAGACTATGATAAGCTATTA
GGAAAAAACGTTAAGTGTATTATAGTCTCTGGTATATTAGGTAAATAAATAAACAATCTA
TCAAATAATCAAATGAGATTATTTCTAAAAATGAAATTGATGATTTTTTTTAAAATATTT
TTTAGGTAATTTTTATAGTTGTTATGTGTAAAATGGCGGAGTTTATTTATAGAATTTTGA
TTCTTATCAACCAAGTAGCTCAAATCCTATAGTTGTTCAGATATTTGGTGTAACAAACCC
TAATATAGCTTATACTAATACTGGTTAGTTCTCGATATCATTGCTATATAAAGGGGATAA
CAAATTCATCAATTCATAATCTTAGGCAGGATAATTATAAATGTACGGAAATCCAGGATG
GTTATCTGTTTAGACTGTAACAGCTAGTTAATTTAATGTGAGGTACACTGCTAGTTATTA
ATTTTCTTTTACTCTAAGTAAGAATGTTCCAAAGATTTTATCATAAGGAGCAATATTTAT
AGATTTTCCTCCTTAATTTGATTAAGTCTCAGACGGAAGAGGCTCTTGTACAACTACAAC
AGCTTCTTTCGCTTAGGTTATAGATTGTTACACCATTCAAAATCGTTACAATGTAACAGG
TAATACTCAAGATTTCTCTGGTTAGCTTTAGGTATCAATAGCGTCGGTTCTAAATCCTAC
TTTCTAAGGAATTACTGATAACTTTTATGTAAGTTCATTTGATGGCATAAACCAAATTAT
TATTGATAGAAGCTACATAAATTTAGATCCATTTTCATTTAGCTACGTTTATCCTGGTCC
ACTGATTCACGTAAATAATGATTAAGGCATCTCACTCTACCCTGGTACATAAACTGTTGA
TCTATATATTACACTAGATTTCCCTTCATTACTTGAGTTAAGTGTAAAGCCAAATATCTT
ACCAGGTTTCAAAGTAATCCCATTCGACATTCCTATTCATCTAGGTTAGACATCCATCCC
TTTCAGAATATCCTGCCCATAATAAATATTTTCTGGTTCTTATACACTCTAATGGGTAAC
ACTAGGAGATAATGTGCCTCCCATCTACACACCAATATAAACTTCTTAAATTACTATCCT
CAATCCTACAAGTAAAAAAAAAAAATAAAATTATAGCTTATTAAAATTATTTAAAATTTA
TTGATTTTTTACTTTAAGGTTGATATTAAATTATTATGATATCAAATTAAAAAAGTAAGT
CAAATTTTTTAGTTTTTATTAAAAACAGGAAAAAAAATTAATTTTTAAATAAATTTTGAA
ACTTAAAGATAAAATTTTTATAAAAATCTTTAATATTTTATTTAATACAATTAAATTAAT
AAAACAAATTTAACACAAATGTTCCTTTTAAAAATCAAAGATTTGAATAGTTTTATTAGT
AATATAAATTTTAATTAAACTAATTAAAATGAAAAATATATATTAATTCACTAACTAAAC
ATTTACTAAATTTTATATTTTAAAAAAGAAAATAGCTTGAAACTAATTTTCTTTCTTTTT
TTATTTTATCTTTTTTAATTTTTGTTAAATAGCCAAAAAAAAAATTTTATAATAAATTAT
ATAATTTTTGTTTGAATCAATAGTTTAAACTGTGCTCATGAACTCTATCTTAGATATTCC
TTATGGAGGAACTTCTTTAGACACAATACTTTCTGTGACTTATGCATCTGATATTTATTT
TGAAGTCCATATGAATTTAGCCTCTTAGTATCCAGGAATTTCATTAAGTACTTAAATGCT
AAATTTCACCAAAGGAATAAACTAGCTCAGTTTTAGAGTTATTTCTACTCCTACAAATAA
TACTAGTTCATCTGTTTCAAGAGGTTCTATAGTTTTCTCATTATTGGGAATAGATTCAAC
TATATTTTAACTACAATATACTTAAATGTACTTCAATTTAATAGCGGCTGATAACATAGC
ACCTCAAATTATTTAGCTTCAGACAGTTAATATATTAAAAAATAGTGTTTAAATTAACGT
TATGACTAATGAACCAACTGTAGTTTACTATATGTGTAGTTTAAATGGAACATCATATCC
AAGCTTCTCTTAAGTTTTTAATAAAACTGCTCCTCCTGCCAATACTACTTAAAGCTAATA
TGGATAATTAGTCTTAAATTAAGCTAATGCAAACTTTTACTTTAACATAACAAACCTCAC
TGCCCAAACTCCTTATATCATCCATCTATTTTTCTAAGATAGAGGAAATAATGTTGCAAA
TAAGACTCTAACTTTTGTCACAAGCAGTAAATTTAATTTAAAGTAAATTTTATCACTAAT
TAACATCATTAACAAAAAGATCGATATAATGCCGCAACATTTAGTCTGAGATTCTAAGTC
CTTTAACTATCAGCTACTGAAATCAAGAGCGTGCTTATTAATTTATCGAATATTTTAACT
ATTGATTTGAATACGTAAATTAATAAATAGAAATTTAAATAAATTAATTTTAATTTTAAT
TTTATATCATCAATTTTTATTAATATTATTTTTGAATTGGTTGTTTTCGTTTTCGCTTAT
TAATTAAAAAAAATTTACTAAATTTATAACTACAAATTTATTAAATAGCTTGTACATCTA
GAAATATTATTTTAATAATACCTCCTCAAGTACTAGCTCAAGTAGAATTCTGTAAAGCAC
ACAATTAGCTGATTAAATAAACCAAATTTAAGAAACTACAGATAATCAAGGTAATTAAAA
AAGATAAAAGGCTAATAGAATATTAGATGTTTCGACTTCAATTTATACTTTACTGAACAT
CTAAATATCTTCAAATAGACTCGTAGAGTATTATCCTTCGCCATTAACTTTAGCTAATTC
TTTGAACAATAAAACTGTATTGCTGAAAGCTGCAATGCCCACTTATGATAGCTCGTATTT
AGTAATCCCAAACACATTTGTATCCTACTATCCTAATTTTATTTAGCCTCCTTAATTTTT
GTCTAATGACTGGTCTACTGCTAATTTCACAGTCGTCTTAGACTAACCAGGATTTGTTTA
TGTGACTGGAGAGTTATATGTCTCAAATACCTAGCCCTCTCCTTATCCTGATTAAATTTA
TTGGGGTTATGACCATACAAACATTAAAGCACCTAGCGGATATGTAGAAGTAAGCTAAGG
ATATACTTAATTTAACTTAACTCTACGTAACCTTAAACCAAATTCAAAGTATTTTGCTTA
CATAATTGGAGGAAGTGTCCAGCCTGGATACCCAGATTTAATGGACGCATCCAAAATAGT
AAGAATTTAATTTACAACACTTCCTTCACCTTCAGGTAAATTTAATTTACTTTAAAGAAA
AAATGTGAAAATTAAATATTTTTAATTAATGAATATAGATTTAGAACTAGATATAAATAC
TGGAACCAAATTAGAATTTAGCACTAAATTTCTAGTGCTACTATTTTTAATTATTTAAGT
ATTCATATGA