Identifiers and Description

Gene Model Identifier

TTHERM_00833740

Standard Name

THD18 (Tetrahymena Histone Deacetylase 18)

Aliases

PreTt14157 | 144.m00120

Description

transcriptional regulator, Sir2 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF02146 ) transcriptional regulator, Sir2 family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00833740

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10210.19.997093137033517e-262transcriptional regulator, Sir
2 family protein (1549 aa)
OxytrichaContig21344.0.g341.9991517704232713e-32Sir2 family
Stentor CoeruleusSteCoe_307930.0000000000002543665647376923
DictyBaseDDB_G02709280.00000000019994075865167896sir2E on chromosome: 1 positio
n 3398987 to 3400602
SGDYDR191W0.0000000400154582995175HST4 Member of the Sir2 family
of NAD(+)-dependent protein d
eacetylases; involved along wi
th Hst3p in silencing at telom
eres, cell cycle progression,
radiation resistance, genomic
stability and short-chain fatt
y acid metabolism
WormBaseWBGene000048020.0000029996948234116693locus:sir-2.3 NAD-dependent
protein deacetylase sir-2.3
status:Partially_confirmed U
niProt:Q20481 protein_id:CAA
90547.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18178773: Smith JJ, Torigoe SE, Maxson J, Fish LC, Wiley EA (2008) A class II histone deacetylase acts on newly synthesized histones in Tetrahymena. Eukaryotic cell 7(3):471-82

Sequences

>TTHERM_00833740(coding)
ATGGAATAAACTGATAATAGCAGCAAACAAACTTAGCAATAAGAAGAAACGAAAGATTGT
AGAAACTGCTCTTATGAAGAAACCATGAAAACGATTGAAGAGACAAGACTAAATTGTTAA
AGGACAATGCAAATTTGCAACTAATCAATATAAACTATTGGAGAATCTATCAAAACAGCC
AATGAAGCAAAATAAAATATCGATGGCTTTTTCGATTAGTACAATTAAGCTATGAACAGC
TTGAGCGAGAAAATTTCTGGATCGTTCTCAGGAATGAGTCGTTGTTTTTTAAAAAATGAG
AACACTGATAAGTAATTTGAAGATTCAAGATAAATAACAGTTAAAGAAGGTGCATAATTT
TTCAAAGACAAGAAAAAAGTTGTTTTTTTGACAGGAGCTGGTATTTCAGTAGCAAGTGGA
ATTCCAACATTCAAAGGAGTTGGTGCTGCACCTCTTTTTGAAAAGGACGGAGTTACTTAT
CAAAATGAACAAATTTCTACTTATAATTTTATGAAAAACAAACCAGATATTTTTTGGGAA
AGAAATTTGATATTCTTAGGAGGTTAATTGGGAAAGAAATACAATGTATCTCACTTAAAG
ATTCAATAATTAGTCAATTAGTATAAATAAATCAAGACATCTTAACTTGGGAAGCAAAAT
GCTTATCAACCCTAAGCAGTAATTGTGACATAAAATACAGATGGTCTTCATTGCTAAGCT
TTTAATGAGTTAAATCCCAGAGAAACAAATTACATGAACAAAGATGATCCTCAATATGGA
TTTTGCCCTGATGTCTTTGAAGTTCATGGCAGTAAAACTTTCCTTAGATGTGATAATTAA
GAATGCAAAGATTATGACAAAAAGTTTTTGTACCCACAAAAATATGATTCTTACAAAGAC
TTCATTTGCGAAACTTGTAAAACCTAAGCTAGACCAAATGTATTGTACTTTGATGAATCT
TATGATGAAAAAAATTATAGGATAAACACTTTGAATGAATTAACTTCTGACATGGATCTA
TTGATATCTATAGGAACATAATTAGACACAGGATATGCTGCTTAAACTGTCAGTAATGCA
GTTCAATAAAAGATTCCAGTCATAGAAATATCTTTAACACCTGTCATATAAAAAGGAGGT
CTAACTCTGAAAGGAAAAGCAGAAGAAGTTGTACCTCAATTATGTGATTTAGTTATGGAA
TTAAATAAATAATTATTACCCACACAACAAAAAGTAGCAAATAAATCAATTGCTTAGAAA
AGTTAAAATCTACTAAAAGATTAAAATAATAAAAGCAATAGCTGTTTATAATCTACAAAT
ACCAGTAAATCTTCCATTTCTAATAAAGTATCAACTAATTCTGCTTAATCTGCAGTAAAA
ACTCTTAATTAAAACCAAGATAATACCTAAACTAATTAAAAACCATAAGTAAAATAAGTC
AGTTTTAGAAAGCCAAATATTAAAGTTGGTCTAAACACAAAGGTAAAAAAGTGA


>TTHERM_00833740(protein)
MEQTDNSSKQTQQQEETKDCRNCSYEETMKTIEETRLNCQRTMQICNQSIQTIGESIKTA
NEAKQNIDGFFDQYNQAMNSLSEKISGSFSGMSRCFLKNENTDKQFEDSRQITVKEGAQF
FKDKKKVVFLTGAGISVASGIPTFKGVGAAPLFEKDGVTYQNEQISTYNFMKNKPDIFWE
RNLIFLGGQLGKKYNVSHLKIQQLVNQYKQIKTSQLGKQNAYQPQAVIVTQNTDGLHCQA
FNELNPRETNYMNKDDPQYGFCPDVFEVHGSKTFLRCDNQECKDYDKKFLYPQKYDSYKD
FICETCKTQARPNVLYFDESYDEKNYRINTLNELTSDMDLLISIGTQLDTGYAAQTVSNA
VQQKIPVIEISLTPVIQKGGLTLKGKAEEVVPQLCDLVMELNKQLLPTQQKVANKSIAQK
SQNLLKDQNNKSNSCLQSTNTSKSSISNKVSTNSAQSAVKTLNQNQDNTQTNQKPQVKQV
SFRKPNIKVGLNTKVKK


>TTHERM_00833740(gene)
ATGGAATAAACTGATAATAGCAGCAAACAAACTTAGCAATAAGAAGAAACGAAAGATTGT
AGAAACTGCTCTTATGAAGAAACCATGAAAACGATTGAAGAGACAAGACTAAATTGTTAA
AGGACAATGCAAATTTGCAACTAATCAATATAAACTATTGGAGAATCTATCAAAACAGCC
AATGAAGCAAAATAAAATATCGATGGCTTTTTCGATTAGTACAATTAAGCTATGAACAGC
TTGAGCGAGAAAATTTCTGGATCGTTCTCAGGAATGAGTCGTTGTTTTTTGTAAGTAAAT
CATTCGCTTATTTAAACAACTAAATTTTTTTTTTTAACCAAAAAGAAAAAATGAGAACAC
TGATAAGTAATTTGAAGATTCAAGATAAATAACAGTTAAAGAAGGTGCATAATTTTTCAA
AGACAAGAAAAAAGTTGTTTTTTTGACAGGAGCTGGTATTTCAGTAGCAAGTGGAATTCC
AACATTCAAAGGAGTTGGTGCTGCACCTCTTTTTGAAAAGGACGGAGTTACTTATCAAAA
TGAACAAATTTCTACTTATAATTTTATGAAAAACAAACCAGATATTTTTTGGGAAAGAAA
TTTGATATTCTTAGGAGGTTAATTGGGAAAGAAATACAATGTATCTCACTTAAAGATTCA
ATAATTAGTCAATTAGTATAAATAAATCAAGACATCTTAACTTGGGAAGCAAAATGCTTA
TCAACCCTAAGCAGTAATTGTGACATAAAATACAGATGGTCTTCATTGCTAAGCTTTTAA
TGAGTTAAATCCCAGAGAAACAAATTACATGAACAAAGATGATCCTCAATATGGATTTTG
CCCTGATGTCTTTGAAGTTCATGGCAGTAAAACTTTCCTTAGATGTGATAATTAAGAATG
CAAAGATTATGACAAAAAGTTTTTGTACCCACAAAAATATGATTCTTACAAAGACTTCAT
TTGCGAAACTTGTAAAACCTAAGCTAGACCAAATGTATTGTACTTTGATGAATCTTATGA
TGAAAAAAATTATAGGATAAACACTTTGAATGAATTAACTTCTGACATGGATCTATTGAT
ATCTATAGGAACATAATTAGACACAGGATATGCTGCTTAAACTGTCAGTAATGCAGTTCA
ATAAAAGATTCCAGTCATAGAAATATCTTTAACACCTGTCATATAAAAAGGAGGTCTAAC
TCTGAAAGGAAAAGCAGAAGAAGTTGTACCTCAATTATGTGATTTAGTTATGGAATTAAA
TAAATAATTATTACCCACACAACAAAAAGTAGCAAATAAATCAATTGCTTAGAAAAGTTA
AAATCTACTAAAAGATTAAAATAATAAAAGCAATAGCTGTTTATAATCTACAAATACCAG
TAAATCTTCCATTTCTAATAAAGTATCAACTAATTCTGCTTAATCTGCAGTAAAAACTCT
TAATTAAAACCAAGATAATACCTAAACTAATTAAAAACCATAAGTAAAATAAGTCAGTTT
TAGAAAGCCAAATATTAAAGTTGGTCTAAACACAAAGGTAAAAAAGTGA