Identifiers and Description

Gene Model Identifier

TTHERM_00833750

Standard Name

THD17 (Tetrahymena Histone Deacetylase 17)

Aliases

PreTt14158 | 144.m00121

Description

transcriptional regulator, Sir2 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF02146 ) transcriptional regulator, Sir2 family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00833750

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10210.19.997093137033517e-262transcriptional regulator, Sir
2 family protein (1549 aa)
OxytrichaContig21344.0.g349.000751454575209e-33Sir2 family
Stentor CoeruleusSteCoe_307930.0000000000002543665647376923
DictyBaseDDB_G02709280.00000000006996681903814525sir2E on chromosome: 1 positio
n 3398987 to 3400602
WormBaseWBGene000048000.000000004999139696582238locus:sir-2.1 status:Partial
ly_confirmed UniProt:D3YT50
protein_id:CBK19468.1
SGDYDR191W0.00000030014504373857585HST4 Member of the Sir2 family
of NAD(+)-dependent protein d
eacetylases; involved along wi
th Hst3p in silencing at telom
eres, cell cycle progression,
radiation resistance, genomic
stability and short-chain fatt
y acid metabolism

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18178773: Smith JJ, Torigoe SE, Maxson J, Fish LC, Wiley EA (2008) A class II histone deacetylase acts on newly synthesized histones in Tetrahymena. Eukaryotic cell 7(3):471-82
  2. Ref:SUPR000181

Sequences

>TTHERM_00833750(coding)
ATGGAATAAACTGATAATAGCAACAAACAAACTTAGCAATAAGAAGAAACGAAAGATTAT
AGAAACTGCTCTTATGAAGAAGTCATGAAAATGATTGAAGAGACAAGATTGAATTGTTAA
AGGACAATGCAAATTTGCAACTAATCAATTTAAAGTATTGGAGAATCTATCAAAACGGTC
AATGAAGCAAAATAAAATATCGATGGCTTTTTCGATTAGTACAATTAAGCTATGAACAGC
TTGTGCGAGAAAATTGCTGGATCATTCTCAGGAATGAGTCGTTGTTTTTTAAAAAATGAG
AACACTGATAAGGAATTTGAAGATTCAAGATAAATAACAATCTAAGAAGGTGCATAGCTT
TTCAAAGACAAGAAAAAAGTTGTTTTTTTAACAGGAGCTGGCATTTCAGTTGCAAGTGGA
ATTCCAACATTTAGAGGAGTTGGTGCTGCACCTCTATTTGAAAAAGACGGTGTTACCTAT
TAAAATGAAGAAATTTCTACTTACAATTTTATGAAAAACAAACCAGATATTTTTTGGGAA
AGAAATTTGATATTCTTAGGAGGTTAATTGGGAAAGAAGTACAATGTATCTCACTTAAAG
ATTCAATAATTAGTCAATTAGTATAAATAAATCAAGACATCTTAACTTGGGAAGCAAAAT
GCTTATCAACCCTAAGCAGTAATTGTGACATAAAATACAGACGGTCTTCATTGCTAGGCA
TTTAATGAGTTAAATCCCAGAGAAACAAATTACATGAACAAAGATGATCCTCAATATGGA
TTTTGCCCTGATGTATTTGAAGTTCATGGTAGTAAAACTTTCCTTAGATGTGATAATTAA
GAATGCAAAGATTATGATAAAAAGTTTTTGTACCCATAAAAATATAATTCTTACAAAGAC
TTCATATGCGAAACTTGTAAAACTTAAGCTAGACCAAATGTGTTGTACTTTGATGAATCA
TATAATGAAAAAAATTATAGGATAAACACTTTGAAAGAATTAACTTCTGATATGGATCTA
TTGATATCTATAGGAACATAATTAGACACAGGATATGCTGCTTAAACTGTCAGTAGTGCA
GTTCAATAAAAGATTCCAGTCATAGAAATATCTTTAACACCAGTCATATAAAAAGGAGGT
CTAACTCTGAAAGGAAAAGCAGAAGAAGTTGTACCTCAATTATGTGATTTAGTAATGGAG
TTAAATAAATAATATTTGTAAAATAAATAATTACCCACACCACAACAAAAAGTAGCAACT
AAATCAATTGCTTAGAAAAGTTAAAACCCACTAAAAGATTAAAATTATAAAAGTAATAGC
AGTTTACAATCAACGAATACCAGCAACTCTTCCATTTCTACTAAAGTCTCAACTAATTCT
GCTAAACCTGCAGTAAAACCTCTTAATTAAAACCAAGCGAATACTAAAACTAATTAAAAA
CCATAAGTAAAATAAGTCAGTTCTACAAAGCCAAATGTTAAAATTGGTCTAACCACAAAG
GAAAAAAAGTGA


>TTHERM_00833750(protein)
MEQTDNSNKQTQQQEETKDYRNCSYEEVMKMIEETRLNCQRTMQICNQSIQSIGESIKTV
NEAKQNIDGFFDQYNQAMNSLCEKIAGSFSGMSRCFLKNENTDKEFEDSRQITIQEGAQL
FKDKKKVVFLTGAGISVASGIPTFRGVGAAPLFEKDGVTYQNEEISTYNFMKNKPDIFWE
RNLIFLGGQLGKKYNVSHLKIQQLVNQYKQIKTSQLGKQNAYQPQAVIVTQNTDGLHCQA
FNELNPRETNYMNKDDPQYGFCPDVFEVHGSKTFLRCDNQECKDYDKKFLYPQKYNSYKD
FICETCKTQARPNVLYFDESYNEKNYRINTLKELTSDMDLLISIGTQLDTGYAAQTVSSA
VQQKIPVIEISLTPVIQKGGLTLKGKAEEVVPQLCDLVMELNKQYLQNKQLPTPQQKVAT
KSIAQKSQNPLKDQNYKSNSSLQSTNTSNSSISTKVSTNSAKPAVKPLNQNQANTKTNQK
PQVKQVSSTKPNVKIGLTTKEKK


>TTHERM_00833750(gene)
AGTTAATTAAAATCAATACAACTAAATAAGTATTTTTATTTACAAATATAAATGGAATAA
ACTGATAATAGCAACAAACAAACTTAGCAATAAGAAGAAACGAAAGATTATAGAAACTGC
TCTTATGAAGAAGTCATGAAAATGATTGAAGAGACAAGATTGAATTGTTAAAGGACAATG
CAAATTTGCAACTAATCAATTTAAAGTATTGGAGAATCTATCAAAACGGTCAATGAAGCA
AAATAAAATATCGATGGCTTTTTCGATTAGTACAATTAAGCTATGAACAGCTTGTGCGAG
AAAATTGCTGGATCATTCTCAGGAATGAGTCGTTGTTTTTTGTAAGTATATCATTCACTT
ATTTAAACAACTAAATAAATTTTTTAAACATTAAAGAAAAAATGAGAACACTGATAAGGA
ATTTGAAGATTCAAGATAAATAACAATCTAAGAAGGTGCATAGCTTTTCAAAGACAAGAA
AAAAGTTGTTTTTTTAACAGGAGCTGGCATTTCAGTTGCAAGTGGAATTCCAACATTTAG
AGGAGTTGGTGCTGCACCTCTATTTGAAAAAGACGGTGTTACCTATTAAAATGAAGAAAT
TTCTACTTACAATTTTATGAAAAACAAACCAGATATTTTTTGGGAAAGAAATTTGATATT
CTTAGGAGGTTAATTGGGAAAGAAGTACAATGTATCTCACTTAAAGATTCAATAATTAGT
CAATTAGTATAAATAAATCAAGACATCTTAACTTGGGAAGCAAAATGCTTATCAACCCTA
AGCAGTAATTGTGACATAAAATACAGACGGTCTTCATTGCTAGGCATTTAATGAGTTAAA
TCCCAGAGAAACAAATTACATGAACAAAGATGATCCTCAATATGGATTTTGCCCTGATGT
ATTTGAAGTTCATGGTAGTAAAACTTTCCTTAGATGTGATAATTAAGAATGCAAAGATTA
TGATAAAAAGTTTTTGTACCCATAAAAATATAATTCTTACAAAGACTTCATATGCGAAAC
TTGTAAAACTTAAGCTAGACCAAATGTGTTGTACTTTGATGAATCATATAATGAAAAAAA
TTATAGGATAAACACTTTGAAAGAATTAACTTCTGATATGGATCTATTGATATCTATAGG
AACATAATTAGACACAGGATATGCTGCTTAAACTGTCAGTAGTGCAGTTCAATAAAAGAT
TCCAGTCATAGAAATATCTTTAACACCAGTCATATAAAAAGGAGGTCTAACTCTGAAAGG
AAAAGCAGAAGAAGTTGTACCTCAATTATGTGATTTAGTAATGGAGTTAAATAAATAATA
TTTGTAAAATAAATAATTACCCACACCACAACAAAAAGTAGCAACTAAATCAATTGCTTA
GAAAAGTTAAAACCCACTAAAAGATTAAAATTATAAAAGTAATAGCAGTTTACAATCAAC
GAATACCAGCAACTCTTCCATTTCTACTAAAGTCTCAACTAATTCTGCTAAACCTGCAGT
AAAACCTCTTAATTAAAACCAAGCGAATACTAAAACTAATTAAAAACCATAAGTAAAATA
AGTCAGTTCTACAAAGCCAAATGTTAAAATTGGTCTAACCACAAAGGAAAAAAAGTGAAA
TAAAATAATAAAACTAAATAAATTATCTACAAATTTTAATAATTATTTAATAAGAAATGT
AAATAAGTATTAGCTATAAATGAATTGATAAGAAATTTATTGTAAATATAAATATATTAA
TTAATATTTTAATAATAGTAATAATCT