Identifiers and Description

Gene Model Identifier

TTHERM_00194150

Standard Name

THD16 (Tetrahymena histone deacetylase 16)

Aliases

PreTt06699 | 16.m00355 | THD16

Description

Sir2-like histone deacetylase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01583 ) adenylylsulfate kinase
  • ( PF02492 ) CobW/P47K family protein
  • ( PF01926 ) GTPase of unknown function
  • ( PF07683 ) CobW/P47K C-terminal domain
  • ( TIGR02881 ) stage V sporulation protein K
  • ( TIGR00073 ) hydrogenase accessory protein HypB
  • ( TIGR02475 ) cobalamin biosynthesis protein CobW
  • ( PF03205 ) Molybdopterin guanine dinucleotide synthesis protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00194150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03684.19.997093137033517e-262transcriptional regulator, Sir
2 family protein (335 aa)
DictyBaseDDB_G02815892.0008958828286524e-54DDB_G0281589 on chromosome: 3
position 4676319 to 4677638
OxytrichaContig13731.0.g814.999083770298882e-50CobW/HypB/UreG, nucleotide-bin
ding domain
SGDYNR029C4.001033848388204e-30YNR029C Putative protein of un
known function, deletion confe
rs reduced fitness in saline

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18178773: Smith JJ, Torigoe SE, Maxson J, Fish LC, Wiley EA (2008) A class II histone deacetylase acts on newly synthesized histones in Tetrahymena. Eukaryotic cell 7(3):471-82
  2. Ref:SUPR000120
  3. Ref:SUPR000155
  4. Ref:SUPR000102

Sequences

>TTHERM_00194150(coding)
ATGGAAAAGCAAAACCAAAAAACAGCTATGGTATTACTTACAGGATATTTAGGTTCTGGT
AAGACTACTCTGATATCATATATTTTAAAAGAATAAAACACATATAAAGTTGCTGTTGTT
TAAAATGAATTCGCTGACGAAATGGGTATAGAAGCACCATTAATGCAAGATTCAGAAGGT
AAGCCCTTTGATAAATTCTACGAACTTCCTAATGGTTGTATATGCTGTACTGCAAAAGAT
GATTTACTTACTGCTGTAGAGTATTTGATTTAGAATGAAAAGTCTAAACTAGATTTTATT
TTAGTCGAAACAAATGGATTAGCTGATCCTTCTTCTACCATAAAAAGCTTTTGGGTTGAT
GAAAATATAGATTTTCCTGCAGAATTAAGGGCTATTCATACAGTTGTACCTGTGCATAGA
TATGAGTAACTTAAAAGCGATTAAATTTTCTAAAGATAAATTTTATATGCTGATAATATA
CTGTTAAATTAGATAGATAAATCTAATGAAGAAGAAATCTAGAATGTGGAAAAGTAAATT
CGTCAACTCAATCCAATTGCCAAATTTGAAAGGTCTTCTTATTGCAAAATAGACTTAAAT
AGAATTTTTGAAATTGATGGGTTTAACTTGAGAAAGAGTAAATCAGAGGCAATCGAAATA
TTAAATAAAATTAGCTAGGAACATGAGCATGATCATGCTCATGCAGATGGAGATATTTAA
TATCAATTTTTTGAATATGCTGCAAACCCTTTTGATGAAAAGGAATTAGAAATCAAGTTA
GGTGAATTACTTTGGGAGAATGAAAAAATAAAAGTTTTAAGAATGAAAGGTTTGATTCAC
ATTAAAGACGATGATTTTATGTATTCTCTCTAAGGTGTAGAAGACATATTTGAAATCAAA
AAAACAGATGTAATGTGGCCAGAAACCCAACAGAGGAAATCAAAATTTTTATTTATTTGC
TAGAATGCTACAAAATAAGAATTGATAGATATCATTACAAATTGA


>TTHERM_00194150(protein)
MEKQNQKTAMVLLTGYLGSGKTTLISYILKEQNTYKVAVVQNEFADEMGIEAPLMQDSEG
KPFDKFYELPNGCICCTAKDDLLTAVEYLIQNEKSKLDFILVETNGLADPSSTIKSFWVD
ENIDFPAELRAIHTVVPVHRYEQLKSDQIFQRQILYADNILLNQIDKSNEEEIQNVEKQI
RQLNPIAKFERSSYCKIDLNRIFEIDGFNLRKSKSEAIEILNKISQEHEHDHAHADGDIQ
YQFFEYAANPFDEKELEIKLGELLWENEKIKVLRMKGLIHIKDDDFMYSLQGVEDIFEIK
KTDVMWPETQQRKSKFLFICQNATKQELIDIITN


>TTHERM_00194150(gene)
ATGGAAAAGCAAAACCAAAAAACAGCTATGGTATTACTTACAGGATATTTAGGTTCTGGT
AAGACTACTCTGATATCATATATTTTAAAAGAATAAAACACATATAAAGTTGCTGTTGTT
TAAAATGAATTCGCTGACGGTAATTATTTATTTATTTAATTACTAAATTACAAAAAAAAA
TGAGTAGAATTTATTATTCAAATCCATCTTTTTCTTAAGATGTCTTTTTGAATTTTAGAC
TTTGTAAGAAATTAAACATAAATATAATAGAAATGGGTATAGAAGCACCATTAATGCAAG
ATTCAGAAGGTAAGCCCTTTGATAAATTCTACGAACTTCCTAATGGTTGTATATGCTGTA
CTGCAAAGTATTTTAAACTTACTTTACTAATAAAGATATTAAAATTAACAATTAACAATT
TTCATCATTTATAGAGATGATTTACTTACTGCTGTAGAGTATTTGATTTAGAATGAAAAG
TCTAAACTAGATTTTATTTTAGTCGAAACAAATGGATTAGCTGATCCTTCTTCTGTAAAT
ATATTTTTATTTTTAATAATTTATAAAATATTTATATAAAATAGACCATAAAAAGCTTTT
GGGTTGATGAAAATATAGATTTTCCTGCAGAATTAAGGGCTATTCATACAGTTGTACCTG
TGCATAGATATGAGTAACTTAAAAGCGATTAAATTTTCTAAAGATAAATTTTATATGCTG
ATAATATACTGTTAAATTAGATAGTAATTACTATTTATTCAATTAGCAATTATAAAGTTA
AACTTACTATTAAAGGATAAATCTAATGAAGAAGAAATCTAGAATGTGGAAAAGTAAATT
CGTCAACTCAATCCAATTGCCAAATTTGAAAGGTTATAATTATAGATAATATAATAACTA
AAAATTTAATCTAAAAAATAATTCTTAGGTCTTCTTATTGCAAAATAGACTTAAATAGAA
TTTTTGAAATTGATGGGTTTAACTTGAGAAAGAGTAAATCAGAGGCAATCGAAATATTAA
ATAAAATTAGCTAGGAACATGAGCATGATCATGCTCATGCAGATGGAGATATTTAATATC
AATTTTTTGAATATGCTGCAAACCCTTTTGATGAAAAGGAATTAGAAATCAAGTTAGGTG
AATTACTTTGGGAGAATGAAAAAATAAAAGTTTTAAGAATGAAAGGTTTGATTCACATTA
AAGACGATGATTTTATGTATTCTCTCTAAGGGTAATTAGATATTTTTAGCTGTTTTTATT
CATTCAGAAATTTTAAAATATTTTTATTTTATATGTATGTATTGATCACTATAATTTATT
TTTTTGACTTAATAGTGTAGAAGACATATTTGAAATCAAAAAAACAGATGTAATGTGGCC
AGAAACCCAACAGAGGAAATCAAAATTTTTATTTATTTGCTAGAATGCTACAAAATAAGA
ATTGATAGATATCATTACAAATTGA