Identifiers and Description

Gene Model Identifier

TTHERM_00526990

Standard Name

THD14 (Tetrahymena Histone Deacetylase 14; Sirtuin Class III family)

Aliases

PreTt06437 | 66.m00236 | 3722.m00094 | SHD9 | HST2

Description

NAD(+)-dependent protein deacetylase; member of the silencing information regulator 2 (Sir2) family of NAD(+)-dependent protein deacetylases

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01853 ) MOZ/SAS family
  • ( PF02146 ) transcriptional regulator, Sir2 family
  • ( PF02148 ) Zn-finger in ubiquitin-hydrolases and other

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00526990

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13434.19.997093137033517e-262hypothetical protein (3586 aa)
OxytrichaContig9367.0.g581.000296925633081e-74Sir2 family
DictyBaseDDB_G02839179.996907204735647e-62sir2A on chromosome: 4 positio
n 1272110 to 1273864
SGDYPL015C3.00017180903994e-49HST2 Cytoplasmic member of the
silencing information regulat
or 2 (Sir2) family of NAD(+)-d
ependent protein deacetylases;
modulates nucleolar (rDNA) an
d telomeric silencing; possess
es NAD(+)-dependent histone de
acetylase activity in vitro
WormBaseWBGene000048008.003782782428492e-46locus:sir-2.1 NAD-dependent
protein deacetylase sir-2.1
status:Partially_confirmed U
niProt:Q21921 protein_id:CAA
94364.1
Stentor CoeruleusSteCoe_296879.602680054508676e-24

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21933443: Slade KM, Freggiaro S, Cottrell KA, Smith JJ, Wiley EA (2011) Sirtuin-mediated nuclear differentiation and programmed degradation in Tetrahymena. BMC cell biology 12( ):40
  2. Ref:18178773: Smith JJ, Torigoe SE, Maxson J, Fish LC, Wiley EA (2008) A class II histone deacetylase acts on newly synthesized histones in Tetrahymena. Eukaryotic cell 7(3):471-82
  3. Ref:SUPR000087

Sequences

>TTHERM_00526990(coding)
ATGAGTTCTGAAATTAGTAAAACAGATTTAAGCAATTTAGAATCAAATACAGATTCTATG
AGCGAGGCTTAGAAGGAAGCTTAATTAATTGGGTTTGCTGTAGAACCTAAGCTTGACTGC
CCTCATTTTGAATAGCTTAATGTTATCACTTTGACAGAAGTCTTTAATGATATGACATTA
GAAACTTTAAATAAGCCTTGTAAGACTTGTAACCATATTGGAGAAAACTGGATTTGCTTA
CATTGTACTGACATATTTTGCTCTAGATATATAAATAAAGATATGGCTAAACACGTTGAA
AGCAATTAAGAGCACTGTCTAGTATTTTCTTTTTCTGATGGTAGTTTTTGGTGCTACAAA
TGTGATAATTACATTTCAAATAAAACTATTAAGGATCTTTAGAAAACATTTTCAAAGGTT
AAGCATGGAGGATAAGAATCAAATGAAGAAGAAGAAGAAAAAGAAGATGATATTCATGCA
ATAGCTGCTTAACTTCTTTAGATGCATCTAAACAAAAAAGGTTAAGATGGTATTTAAGAA
GAATTTACCTACTAAAATTTAATTGATGGTTTGAGAGATATTTCTCCTGATTAAGAGAAA
AATTAAGATGACAAATACAATAACAGACAGTTCAATCGAATTGTGTTTTTGACTGGAGCA
GGTATTAGTGTGTCTGCTGGTATTCCAGATTTTAGAACTCCTGGATCTGGTTTATACTCC
CAACTCTAGAAATACAAGTTGCCATATCCTGAAGCAATTTTTGAAATAAATTATTTCAAA
CATCATCCATAGCCATTCTATACTCTTTGTAAAGAATTCTCAAGTTGCGGATCTCACTTT
ACTTCTAGTCACTTCTTTATAGCTGAAACTAATAGAAGAAATCGTCTTTTAATTAATTTT
TCTTAAAATATTGACGGATTAGAACTAGAAGCAGGACTTCCTGAATCAAAACTAGTTTAA
GCTCATGGTCATTTTAGAACAGCAAAGTGTGTTAACTGTAAAAAAGTTGCAGATATTGAA
TTATTCAATGAAGCAGTTAAAAATGATAAAATATGTTATTGCAAAGAATGTGAGGAAGGT
ATTGTAAAACCTGATATTGTTTTCTTTGGTGAGAGTCTTCCATAGAGTTTCTTTTAATAA
ATAGACAGCTTAAATAAGGCTGATTTGGTATTCGTCATGGGAACTTCTCTCAAAGTTTTT
CCATTTGCAGCTTTAGTTGATTTATTCAAAGAAGATGTCCCAATAGTATTGATTAATAGA
GAAAACCCTGGAATAAAAAGAAGAAGATTCCTATTTTTAGAAGGTGAAATAGATGACAAT
GTAGAAAAAATTATGAAGGATATTTCTTGGGATTTTCCTGAAATTAAAAGAACATACCCT
GAAGGAACTGTATTAGAGAAGAAATAAAACCTTTGA


>TTHERM_00526990(protein)
MSSEISKTDLSNLESNTDSMSEAQKEAQLIGFAVEPKLDCPHFEQLNVITLTEVFNDMTL
ETLNKPCKTCNHIGENWICLHCTDIFCSRYINKDMAKHVESNQEHCLVFSFSDGSFWCYK
CDNYISNKTIKDLQKTFSKVKHGGQESNEEEEEKEDDIHAIAAQLLQMHLNKKGQDGIQE
EFTYQNLIDGLRDISPDQEKNQDDKYNNRQFNRIVFLTGAGISVSAGIPDFRTPGSGLYS
QLQKYKLPYPEAIFEINYFKHHPQPFYTLCKEFSSCGSHFTSSHFFIAETNRRNRLLINF
SQNIDGLELEAGLPESKLVQAHGHFRTAKCVNCKKVADIELFNEAVKNDKICYCKECEEG
IVKPDIVFFGESLPQSFFQQIDSLNKADLVFVMGTSLKVFPFAALVDLFKEDVPIVLINR
ENPGIKRRRFLFLEGEIDDNVEKIMKDISWDFPEIKRTYPEGTVLEKKQNL


>TTHERM_00526990(gene)
ATGAGTTCTGAAATTAGTAAAACAGATTTAAGCAATTTAGAATCAAATACAGATTCTATG
AGCGAGGCTTAGAAGGAAGCTTAATTAATTGGGTTTGCTGTAGAACCTAAGCTTGACTGC
CCTCATTTTGAATAGCTTAATGTTATCACTTTGACAGAAGTCTTTAATGATATGACATTA
GAAACTTTAAATAAGCCTTGTAAGACTTGTAACCATATTGGAGAAAACTGGATTTGCTTA
CATTGTACTGACATATTTTGCTCTAGATATATAAATAAAGATATGGCTAAACACGTTGAA
AGCAATTAAGAGCACTGTCTAGTATTTTCTTTTTCTGATGGTAGTTTTTGGTGCTACAAA
TGTGATAATTACATTTCAAATAAAACTATTAAGGATCTTTAGAAAACATTTTCAAAGGTT
AAGCATGGAGGATAAGAATCAAATGAAGAAGAAGAAGAAAAAGAAGATGATATTCATGCA
ATAGCTGCTTAACTTCTTTAGATGCATCTAAACAAAAAAGGTTAAGATGGTATTTAAGAA
GAATTTACCTACTAAAATTTAATTGATGGTTTGAGAGATATTTCTCCTGATTAAGAGAAA
AATTAAGATGACAAATACAATAACAGACAGTTCAATCGAATTGTGTTTTTGACTGGAGCA
GGTATTAGTGTGTCTGCTGGTATTCCAGATTTTAGAACTCCTGGATCTGGTTTATACTCC
CAACTCTAGAAATACAAGTTGCCATATCCTGAAGCAATTTTTGAAATAAATTATTTCAAA
CATCATCCATAGCCATTCTATACTCTTTGTAAAGAATTCTCAAGTTGCGGATCTCACTTT
ACTTCTAGTCACTTCTTTATAGCTGAAACTAATAGAAGAAATCGTCTTTTAATTAATTTT
TCTTAAAATATTGACGGATTAGAACTAGAAGCAGGACTTCCTGAATCAAAACTAGTTTAA
GCTCATGGTCATTTTAGAACAGCAAAGTGTGTTAACTGTAAAAAAGTTGCAGATATTGAA
TTATTCAATGAAGCAGTTAAAAATGATAAAATATGTTATTGCAAAGAATGTGAGGAAGGT
ATTGTAAAACCTGATATTGTTTTCTTTGGTGAGAGTCTTCCATAGAGTTTCTTTTAATAA
ATAGACAGCTTAAATAAGGCTGATTTGGTATTCGTCATGGGTAATAAATACAATATTTTT
TTTTAAAGTTATAAATCTTTTAAAATTTAATATAAATAGGAACTTCTCTCAAAGTTTTTC
CATTTGCAGCTTTAGTTGATTTATTCAAAGAAGATGTCCCAATAGTATTGATTAATAGAG
AAAACCCTGGAATAAAAAGAAGAAGATTCCTATTTTTAGAAGGTGAAATAGATGACAATG
TAGAAAAAATTATGAAGGATATTTCTTGGGATTTTCCTGAAATTAAAAGAACATACCCTG
AAGGAACTGTATTAGAGAAGAAATAAAACCTTTGA