Identifiers and Description

Gene Model Identifier

TTHERM_00672190

Standard Name

THD13 (Tetrahymena Histone Deacetylase 13)

Aliases

PreTt10965 | 101.m00120

Description

Sir2-like histone deacetylase; suppresses DNA transcription by deacetylation of histones; homolog of Rattus norvegicus SIRT3

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01344 ) kelch repeat protein
  • ( PF07646 ) kelch repeat protein
  • ( PF04640 ) Protein of unknown function, DUF597
  • ( PF02146 ) transcriptional regulator, Sir2 family
  • ( PF01023 ) S-100/ICaBP type calcium binding domain
  • ( PF00220 ) Neurohypophysial hormones, N-terminal Domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00672190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14307.19.997093137033517e-262hypothetical protein (944 aa)
OxytrichaContig20663.0.g912.9992476920535046e-16Kelch motif
WormBaseWBGene000021860.0002999184360822198locus:kel-10 Kelch repeat-co
ntaining protein kel-10 stat
us:Confirmed UniProt:P34569
protein_id:CAA83141.3

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18178773: Smith JJ, Torigoe SE, Maxson J, Fish LC, Wiley EA (2008) A class II histone deacetylase acts on newly synthesized histones in Tetrahymena. Eukaryotic cell 7(3):471-82
  2. Ref:SUPR000118
  3. Ref:SUPR000071
  4. Ref:SUPR000215
  5. Ref:SUPR000157
  6. Ref:SUPR000232
  7. Ref:SUPR000242

Sequences

>TTHERM_00672190(coding)
ATGATTGATAACTAAAGCGTAAACTAAGAGGGGCAGAACATTTCTTATTCTTGCTAAATT
AGCAATTGCCCAATTAGTAAAAATGGAAACTTTAATGAAGGAGATATTAAATTTTGCACT
GATTGCAATAAACTAATATGCAACACTTGCATAACTAGTCATGATGAAAACCACACCATT
ATTGAAGGTGCTAATTTCGCTTTCATTCAAGAGAATATGTCCAAAGTCCTTCCTAATTTA
GGGAATCTGAGCCCAATTTTGCAAAGTAATAACTTAAATATAAGTAGTGATTCTAAGATG
ATAAGTGAAGATACTCTTCCTGATACAGAGGAAAAAAAAGTTTAAGAGAAATAGAATTTT
AACTATAAATAGCAGCCTTAGTTTTTATAAAAAATAAACGACGATGATGATGAGGATGAT
GATGATAGTGATAGTGATGACGATGATCATATTATGAAAATGAAAAATTTCAGCAATATT
GCTGCATAACTTAAAAATTTAAAAAATGACAGTGATGAAGAAGAGGAGGATGATGAAGAT
GATGATGAAATAAACTTTATAAGCCAAGCTGCAAGTAAATTAACTACTATAGGAAAAGTA
TCTAACTCACCAACAAATACTATGTTTGTAGAATATAACACAAAACCTCCAAGTGAAAAT
CAATTTGATTTTAATTAATAACAATAAATAAATAATGCGAGCTATAAATAGTCAGGTATA
ATGAATGGTACAAACTTTCTTTAAGTTCCTCAAGATTTTAATAATGTAAAACGTATAATC
AACTAAAATTCTTACTAGAATAACAATTATTCAATTAATATAAATGGAGCGAATGGATAT
CAAAACCAGGAATTTAACTCAAACAAATTGTATTAAAATCAGTATGCTCTAACAGAGCTG
TAGAAGGTCTTTTTATAAAAAGAAAAATATTACAATTTGGTGAGCTAGTTTTACAAATAA
AACAAACCAAATAAGAATTTAGTTACTAAAAAGATAGCAGCACAATAAATAAAGAAAAAA
AGAAAAGCTAAAGATGATTTGGGTGGCGATAATGAAAATGATGAAAGTAAAAATTAAGAA
TAAGAAGATATTCCTATTCCTCAAGTTTAAGACCATGTGAAAGAATCTAATAAGAAGTTA
GGGTTACAGGAATTAAAAAATCGTTCTAAGTAGCTCTATGAAGAATTAAAAGCTAAATCT
GATTTGATTTTTAAGGAAATAAAACACCACATTCATGGTGTTCAATACGAGAGAGATGAA
ACAGATAGAATTAATAAATATAAGAAATATGCTCTTGAAGGCATTGAGAGTTATTTCCTC
TATCTTAAAGACTAATTTAAAATTGAGTATTCTAAATTGAAGAAATGTAAAAAGAGAGAA
TAACTAAGTAAAATGATGAACAAAGTAATAGATTGTATAGAAAAATATCAATACTATTCG
GACTAGAAAGATTTTCTTGAATTTATGAACAAAAACTATGATTACTATTTGAATAATATT
GAATTACTCTTACATGAAATTTAAAAAGAGGGCAATGATTTCCCTCCTCAATATAAAATA
GTCTATGAAAATCTCTATGACATATTTTTCTCTCTTATAAGTTACATCTCATTGAACTTG
CCTAACTAAAAAACTTATAGTCAATTTACTTAACCCATAATAAAGACTTAAAGCTCGAAA
TATTTGGTCATCCCTATTCACTATCCAAATAAAAAAATAGTTGGAATATTTAACTGCAGA
AGTAACGAATTAGAATAAATCGAATATGATTGCTCTTAGACTATGGATTTCTAGAAGTAT
AGCAACTTTTAATTGGTTAATGATAGCGATTTTATTTACTTTATTGGAGGAGTAATATTT
AACAAAGAGAAGAGCACCTTTAATCCTAGTTAAAAGTGTTTCAAAATGAGTAGACATTCA
GGGGAAATTATAGCCCTAAAAGACATGCCTTATCCTAAAATGAAGTTTGGAACAATTATG
ATTGGTAATTTTATTTATGTTTTTGGAGGTTTACAAACTCAAGAAAAGCACCGTACCAAT
ACTTGTGAAAAATATGACATTAACACTAACACATGGAAAATATTACCTGTGATGCAAATG
AACAGAGTATGCCCAGTAGTCTCATCTTTCACCACTATAGGTAGTGGCTTTAATTAAAAG
CAATTAATTTACTTATTCGGTGGCATGGAAGACAAAAACAACATTAATTAATCTATTGAA
GTCTTCGACTAAAAGCTAGATATTTGGATTGACTTCTTATAAAAACCAGCAAATAGTAGA
TGCTATATCCCAAAACAACTTGGTTATGGAGTTTAAATTAATTAAGAATAAATCTTAATT
ATCGGAGGTTTATCTGGAAGAAAGCAAAAACCTACATCATAAACTTATGTGTATAATGTT
TCTAAAAATTCCATATGTAATTTAAGTTTAGACTCTTTACCAACAGGAATAATTAAAGAC
TCTTTCACTGGAATGCCTGTTGTTTATGATAACTCAATTTTCCTTCTTAACACTCAAATA
AGCTAATACTTCCCTTCACTAAAATAATTATAAGGAGTAACCAATGTTATAAAGATAGGA
TTGAATCAATAAGAAATTTTAGCAACTCATTGTTTTTGA


>TTHERM_00672190(protein)
MIDNQSVNQEGQNISYSCQISNCPISKNGNFNEGDIKFCTDCNKLICNTCITSHDENHTI
IEGANFAFIQENMSKVLPNLGNLSPILQSNNLNISSDSKMISEDTLPDTEEKKVQEKQNF
NYKQQPQFLQKINDDDDEDDDDSDSDDDDHIMKMKNFSNIAAQLKNLKNDSDEEEEDDED
DDEINFISQAASKLTTIGKVSNSPTNTMFVEYNTKPPSENQFDFNQQQQINNASYKQSGI
MNGTNFLQVPQDFNNVKRIINQNSYQNNNYSININGANGYQNQEFNSNKLYQNQYALTEL
QKVFLQKEKYYNLVSQFYKQNKPNKNLVTKKIAAQQIKKKRKAKDDLGGDNENDESKNQE
QEDIPIPQVQDHVKESNKKLGLQELKNRSKQLYEELKAKSDLIFKEIKHHIHGVQYERDE
TDRINKYKKYALEGIESYFLYLKDQFKIEYSKLKKCKKREQLSKMMNKVIDCIEKYQYYS
DQKDFLEFMNKNYDYYLNNIELLLHEIQKEGNDFPPQYKIVYENLYDIFFSLISYISLNL
PNQKTYSQFTQPIIKTQSSKYLVIPIHYPNKKIVGIFNCRSNELEQIEYDCSQTMDFQKY
SNFQLVNDSDFIYFIGGVIFNKEKSTFNPSQKCFKMSRHSGEIIALKDMPYPKMKFGTIM
IGNFIYVFGGLQTQEKHRTNTCEKYDINTNTWKILPVMQMNRVCPVVSSFTTIGSGFNQK
QLIYLFGGMEDKNNINQSIEVFDQKLDIWIDFLQKPANSRCYIPKQLGYGVQINQEQILI
IGGLSGRKQKPTSQTYVYNVSKNSICNLSLDSLPTGIIKDSFTGMPVVYDNSIFLLNTQI
SQYFPSLKQLQGVTNVIKIGLNQQEILATHCF


>TTHERM_00672190(gene)
ATGATTGATAACTAAAGCGTAAACTAAGAGGGGCAGAACATTTCTTATTCTTGCTAAATT
AGCAATTGCCCAATTAGTAAAAATGGAAACTTTAATGAAGGAGATATTAAATTTTGCACT
GATTGCAATAAACTAATATGCAACACTTGCATAACTAGTCATGATGAAAACCACACCATT
ATTGAAGGTGCTAATTTCGCTTTCATTCAAGAGAATATGTCCAAAGTCCTTCCTAATTTA
GGGAATCTGAGCCCAATTTTGCAAAGTAATAACTTAAATATAAGTAGTGATTCTAAGATG
ATAAGTGAAGATACTCTTCCTGATACAGAGGAAAAAAAAGTTTAAGAGAAATAGAATTTT
AACTATAAATAGCAGCCTTAGTTTTTATAAAAAATAAACGACGATGATGATGAGGATGAT
GATGATAGTGATAGTGATGACGATGATCATATTATGAAAATGAAAAATTTCAGCAATATT
GCTGCATAACTTAAAAATTTAAAAAATGACAGTGATGAAGAAGAGGAGGATGATGAAGAT
GATGATGAAATAAACTTTATAAGCCAAGCTGCAAGTAAATTAACTACTATAGGAAAAGTA
TCTAACTCACCAACAAATACTATGTTTGTAGAATATAACACAAAACCTCCAAGTGAAAAT
CAATTTGATTTTAATTAATAACAATAAATAAATAATGCGAGCTATAAATAGTCAGGTATA
ATGAATGGTACAAACTTTCTTTAAGTTCCTCAAGATTTTAATAATGTAAAACGTATAATC
AACTAAAATTCTTACTAGAATAACAATTATTCAATTAATATAAATGGAGCGAATGGATAT
CAAAACCAGGAATTTAACTCAAACAAATTGTATTAAAATCAGTATGCTCTAACAGAGCTG
TAGAAGGTCTTTTTATAAAAAGAAAAATATTACAATTTGGTGAGCTAGTTTTACAAATAA
AACAAACCAAATAAGAATTTAGTTACTAAAAAGATAGCAGCACAATAAATAAAGAAAAAA
AGAAAAGCTAAAGATGATTTGGGTGGCGATAATGAAAATGATGAAAGTAAAAATTAAGAA
TAAGAAGATATTCCTATTCCTCAAGTTTAAGACCATGTGAAAGAATCTAATAAGAAGTTA
GGGTTACAGGAATTAAAAAATCGTTCTAAGTAGCTCTATGAAGAATTAAAAGCTAAATCT
GATTTGATTTTTAAGGAAATAAAACACCACATTCATGGTGTTCAATACGAGAGAGATGAA
ACAGATAGAATTAATAAATATAAGAAATATGCTCTTGAAGGCATTGAGAGTTATTTCCTC
TATCTTAAAGACTAATTTAAAATTGAGTATTCTAAATTGAAGAAATGTAAAAAGAGAGAA
TAACTAAGTAAAATGATGAACAAAGTAATAGATTGTATAGAAAAATATCAATACTATTCG
GACTAGAAAGATTTTCTTGAATTTATGAACAAAAACTATGATTACTATTTGAATAATATT
GAATTACTCTTACATGAAATTTAAAAAGAGGGCAATGATTTCCCTCCTCAATATAAAATA
GTCTATGAAAATCTCTATGACATATTTTTCTCTCTTATAAGTTACATCTCATTGAACTTG
CCTAACTAAAAAACTTATAGTCAATTTACTTAACCCATAATAAAGACTTAAAGCTCGAAA
TATTTGGTCATCCCTATTCACTATCCAAATGTAATGTTTGTTTCTATTACTTGAAATATC
CTTTCGAATTCAAAAGAAAATATTTTAGAAATATCTAACAAAAGCTATTTTGAATAAAAA
ATAATTTTAAAAAAATTAATTTAAAAATTTTTAATTTTAAAGAAAAAAATAGTTGGAATA
TTTAACTGCAGAAGTAACGAATTAGAATAAATCGAATATGATTGCTCTTAGACTATGGAT
TTCTAGAAGTATAGCAACTTTTAATTGGTTAATGATAGCGATTTTATTTACTTTATTGGA
GGAGTAATATTTAACAAAGAGAAGAGCACCTTTAATCCTAGTTAAAAGTGTTTCAAAATG
AGTAGACATTCAGGGGAAATTATAGCCCTAAAAGACATGCCTTATCCTAAAATGAAGTTT
GGAACAATTATGATTGGTAATTTTATTTATGTTTTTGGAGGTTTACAAACTCAAGAAAAG
CACCGTACCAATACTTGTGAAAAATATGACATTAACACTAACACATGGAAAATATTACCT
GTGATGCAAATGAACAGAGTATGCCCAGTAGTCTCATCTTTCACCACTATAGGTAGTGGC
TTTAATTAAAAGCAATTAATTTACTTATTCGGTGGCATGGAAGACAAAAACAACATTAAT
TAATCTATTGAAGTCTTCGACTAAAAGCTAGATATTTGGATTGACTTCTTATAAAAACCA
GCAAATAGTAGATGCTATATCCCAAAACAACTTGGTTATGGAGTTTAAATTAATTAAGAA
TAAATCTTAATTATCGGAGGTAATAAATAAATTTATTTATTTCAAATAATTAAACAACTC
ATTGAATTTTTATTTAAAAATGTTTTTTAAATTAATTAGGTTTATCTGGAAGAAAGCAAA
AACCTACATCATAAACTTATGTGTATAATGTTTCTAAAAATTCCATATGTAATTTAAGTT
TAGACTCTTTACCAACAGGAATAATTAAAGACTCTTTCACTGGAATGCCTGTTGTTTATG
ATAACTCAATTTTCCTTCTTAACACTCAAATAAGCTAATACTTCCCTTCACTAAAATAAT
TATAAGGAGTAACCAATGTTATAAAGATAGGATTGAATCAATAAGAAATTTTAGCAACTC
ATTGTTTTTGA