Identifiers and Description

Gene Model Identifier

TTHERM_01018450

Standard Name

THD12 (Tetrahymena histone deacetylase 12)

Aliases

PreTt27762 | 199.m00055

Description

Sir2-like histone deacetylase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF02146 ) transcriptional regulator, Sir2 family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_01018450

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01119.19.997093137033517e-262transcriptional regulator, Sir
2 family protein (387 aa)
OxytrichaContig19063.0.g741.0001788721085356e-149Sir2 family
Stentor CoeruleusSteCoe_105971.9503933001302485e-65
WormBaseWBGene000048033.0010664139725277e-29locus:sir-2.4 NAD-dependent
protein deacetylase sir-2.4
status:Confirmed UniProt:Q95
Q89 protein_id:CCD61225.1
DictyBaseDDB_G02839175.998633383648922e-18sir2A on chromosome: 4 positio
n 1272110 to 1273864
SGDYPL015C0.00000000000004998767099442072HST2 Cytoplasmic member of the
silencing information regulat
or 2 (Sir2) family of NAD(+)-d
ependent protein deacetylases;
modulates nucleolar (rDNA) an
d telomeric silencing; possess
es NAD(+)-dependent histone de
acetylase activity in vitro

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18178773: Smith JJ, Torigoe SE, Maxson J, Fish LC, Wiley EA (2008) A class II histone deacetylase acts on newly synthesized histones in Tetrahymena. Eukaryotic cell 7(3):471-82
  2. Ref:SUPR000225
  3. Ref:SUPR000117

Sequences

>TTHERM_01018450(coding)
ATGGATACTGCACACAAAACAGAAGATGAAAAAAAGGAATACTTCGATGCTCCTGATGTT
TTAGAATAAAAGGTTACTCTTTTAGCTGAAATGATTAAAACTTCAAAGCACTTTGTAGCT
TTCACAGGAGCAGGAATTTCTACTTCTACAGGAATTCCTGATTTTAGAAGTGGAATTAAC
ACTGTTCTTCCTACTGGACCAGGAGCTTGGGAGAAATTAGCCTAAAAAGTTGATAATAAG
CATAAAAATATCAAGACTAGCATGTTGAAAGCTATTCCTTCACCCACACATATGGCTTTG
GTTTAGTTACAAAAAATAGGTTATTTGAAATTCCTTATTAGCTAAAATGTAGACGGATTG
CACAGAAGAAGTGGTTTCTCACCCTAACACTTAGCTGAATTGCATGGCAATACAAATCTT
GAAAAATGTAAAAAATGTGGCAAAGAATACTTGAGAGATTTTAGAGTTAGAAATGCATAG
AAAGTTCATGATCACAAAACAGGTAGAAAGTGCAGCGATTAAAAATGCAAAGGAGATCTT
TATGACTCTATTATAAATTTTGGTGAAAATTTACCTGAAAAAGATTTAAATGAAGGATTT
GCTTAATCAAAAAAATCTGATTTGCATTTGGTTTTAGGAAGTAGTTTAAGAGTAACACCT
GCTGCAGACATGCCTGCCACCACTGCAGAAAAAGGTCAAAAATTAGTTATAATAAACTTG
CAAAAAACTCCTTTAGACTCAGTAGCTACTCTCAGAATAAATGCTATGTGTGATGATGTT
ATGAAAATGGTTATGAAAAAACTTGGATTAGATATACCAGAATTCACTCTTGAAAGAAGA
GTTGTCTTAGAAAAAACAGGTATGAATGCCTTAACAGTTTCAAGCTAAGACTCGGACGAT
TCCCCCTATGATTTGTTTAAATAAATTAAAGTAGATTACGGCAAAATACATCCTGAATAA
ACTTTACTTAAGGCTCCATTCAATATCATACCAAAAAATAAAACATTCTCTCTAAATTTA
AGCTTTTATGGACACTATGGCGAGCAAGATTTTAACTTAAATATCGATATGGCTGCTCTC
TCCATTAATAAAAAAGTGAAATATTTAATACAATATTCACCAAAAGAATAAAAATGGATT
AGTTGCAAAGAAATATGA


>TTHERM_01018450(protein)
MDTAHKTEDEKKEYFDAPDVLEQKVTLLAEMIKTSKHFVAFTGAGISTSTGIPDFRSGIN
TVLPTGPGAWEKLAQKVDNKHKNIKTSMLKAIPSPTHMALVQLQKIGYLKFLISQNVDGL
HRRSGFSPQHLAELHGNTNLEKCKKCGKEYLRDFRVRNAQKVHDHKTGRKCSDQKCKGDL
YDSIINFGENLPEKDLNEGFAQSKKSDLHLVLGSSLRVTPAADMPATTAEKGQKLVIINL
QKTPLDSVATLRINAMCDDVMKMVMKKLGLDIPEFTLERRVVLEKTGMNALTVSSQDSDD
SPYDLFKQIKVDYGKIHPEQTLLKAPFNIIPKNKTFSLNLSFYGHYGEQDFNLNIDMAAL
SINKKVKYLIQYSPKEQKWISCKEI


>TTHERM_01018450(gene)
ATGGATACTGCACACAAAACAGAAGATGAAAAAAAGGAATACTTCGATGCTCCTGATGTT
TTAGAATAAAAGGTTACTCTTTTAGCTGAAATGATTAAAACTTCAAAGCACTTTGTAGCT
TTCACAGGAGCAGGAATTTCTACTTCTACAGGAATTCCTGATTTTAGAAGTGGAATTAAC
ACTGTTCTTCCTACTGGACCAGGAGCTTGGGAGAAATTAGCCTAAAAAGTTGATAATAAG
CATAAAAATATCAAGACTAGCATGTTGAAAGCTATTCCTTCACCCACACATATGGCTTTG
GTTTAGTTACAAAAAATAGGTTATTTGAAATTCCTTATTAGCTAAAATGTAGACGGATTG
CACAGAAGAAGTGGTTTCTCACCCTAACACTTAGCTGAATTGCATGGCAATACAAATCTT
GAAAAATGTAAAAAATGTGGCAAAGAATACTTGAGAGATTTTAGAGTTAGAAATGCATAG
AAAGTTCATGATCACAAAACAGGTAGAAAGTGCAGCGATTAAAAATGCAAAGGAGATCTT
TATGACTCTATTATAAATTTTGGTGAAAATTTACCTGAAAAAGATTTAAATGAAGGATTT
GCTTAATCAAAAAAATCTGATTTGCATTTGGTTTTAGGAAGTAGTTTAAGAGTAACACCT
GCTGCAGACATGCCTGCCACCACTGCAGAAAAAGGTCAAAAATTAGTTATAATAAACTTG
CAAAAAACTCCTTTAGACTCAGTAGCTACTCTCAGAATAAATGCTATGTGTGATGATGTT
ATGAAAATGGTTATGAAAAAACTTGGATTAGATATACCAGAATTCACTCTTGAAAGAAGA
GTTGTCTTAGAAAAAACAGGTATGAATGCCTTAACAGTTTCAAGCTAAGACTCGGACGAT
TCCCCCTATGATTTGTTTAAATAAATTAAAGTAGATTACGGCAAAATACATCCTGAATAA
ACTTTACTTAAGGCTCCATTCAATATCATACCAAAAAATAAAACATTCTCTCTAAATTTA
AGCTTTTATGGACACTATGGCGAGCAAGATTTTAACTTAAATATCGATATGGCTGCTCTC
TCCATTAATAAAAAAGTGAAATATTTAATACAATATTCACCAAAAGAATAAAAATGGATT
AGTTGCAAAGAAATATGA