Identifiers and Description

Gene Model Identifier

TTHERM_00313730

Standard Name

THD11 (Tetrahymena Histone Deacetylase 11)

Aliases

PreTt03560 | 30.m00369 | 3810.m01981

Description

Sir2-like histone deacetylase; suppresses DNA transcription by deacetylation of histones

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00313730

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03386.19.997093137033517e-262transcriptional regulator, Sir
2 family protein (387 aa)
OxytrichaContig19063.0.g742.9990837046884738e-127Sir2 family
Stentor CoeruleusSteCoe_105971.1677812485237086e-60
WormBaseWBGene000048031.0000422327488734e-24locus:sir-2.4 NAD-dependent
protein deacetylase sir-2.4
status:Confirmed UniProt:Q95
Q89 protein_id:CCD61225.1
DictyBaseDDB_G02839174.0009493637353324e-18sir2A on chromosome: 4 positio
n 1272110 to 1273864
SGDYPL015C0.000000000000006000101554955223HST2 Cytoplasmic member of the
silencing information regulat
or 2 (Sir2) family of NAD(+)-d
ependent protein deacetylases;
modulates nucleolar (rDNA) an
d telomeric silencing; possess
es NAD(+)-dependent histone de
acetylase activity in vitro

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18178773: Smith JJ, Torigoe SE, Maxson J, Fish LC, Wiley EA (2008) A class II histone deacetylase acts on newly synthesized histones in Tetrahymena. Eukaryotic cell 7(3):471-82
  2. Ref:SUPR000191
  3. Ref:SUPR000128

Sequences

>TTHERM_00313730(coding)
ATGGATACTGCTCATAAAACAGTAAACGAAAAGAAAGAATACTTTGATTCTCCGGAATTA
TTAGAAGCAAAAGTCACTTAGTTGGCAGATATGATTAAATAGTCAAATCACTTTGTTTGC
TTTACAGGTGCTGGAATATCTACTTCAGCAGGTATAGCTGATTTTAGAAGTGGAGTTAAC
ACAGTCTTGAAAACTGGACCTGGTTTGTGGGAAAAGATGGCTTAAAAAGTAGGAAATCAA
CCTAAAAAACACAAAGTTATAATGTCTAGAGCTGTTCCAACTAAAAGCCATATGGCACTA
GTTAAGTTGAATCAAGAAGGAATTCTTAAGTATTTAATCAGTTAAAATATAGACGGCTTA
CATAGAAGAAGTGGATTCAACCCTAATAGCCTATCTGAACTACATGGAAACACTAATTTA
GAGAAATGTTTAAAATGTGGAAAGTCTTATATGAGAGATTATAGAGTGAGAAAAGCTTTA
GATGTTCATGACCACTTAACAGGAAGGATTTGCGACAATTAGAAATGTGGTGGCGAATTA
GTAGATACAATTGTTAATTTTGGAGAGAATTTACCCAAAAAAGATATGGAATAAGGTTTT
TTTAACTCAAAATAAGCAGATTTACACTTAGTTTTAGGAAGTAGTTTAAGAGTTACTCCA
GCAGCTGATATGCCTCTAGCAACTGCTTAAAATGGAAATAAATTAGTTGTGGTTAATTTA
CAAAAAACCCCTCTAGATAGCTTGTGTGCCTTAAGAATATATGCTTTGATTGATGATGTC
ATGGTTCTACTTATGAAAAAGCTAGGTTTAGAGATACCAGAATTTATTCTGCAGAGAACT
ATTGTGATTAAAAAGACAAACTAAAATACAATAAACGTTTTTAGTGAAGACAAAGATGGT
TGTCCATATGACATTTTTAAGTAAATTGTTTTGGATTAAGGCAAAAAGTAACCATTTGAG
ATTTAGGTTAAAGCACCTTACATATTCAATATCACAAATCCATAATTTGCCATAAAGCTA
GGATTTTTTGAACATTATAAAGAAGGACCATTCAGATTAGATTTAAATTTATAAAATCTA
CCTCTTGGATAAAAGACTAAGTATTTAATATAATTCTCACCAAAATTACAAAAGTGGATT
AGTTGTGAAAAAATATAATGA


>TTHERM_00313730(protein)
MDTAHKTVNEKKEYFDSPELLEAKVTQLADMIKQSNHFVCFTGAGISTSAGIADFRSGVN
TVLKTGPGLWEKMAQKVGNQPKKHKVIMSRAVPTKSHMALVKLNQEGILKYLISQNIDGL
HRRSGFNPNSLSELHGNTNLEKCLKCGKSYMRDYRVRKALDVHDHLTGRICDNQKCGGEL
VDTIVNFGENLPKKDMEQGFFNSKQADLHLVLGSSLRVTPAADMPLATAQNGNKLVVVNL
QKTPLDSLCALRIYALIDDVMVLLMKKLGLEIPEFILQRTIVIKKTNQNTINVFSEDKDG
CPYDIFKQIVLDQGKKQPFEIQVKAPYIFNITNPQFAIKLGFFEHYKEGPFRLDLNLQNL
PLGQKTKYLIQFSPKLQKWISCEKIQ


>TTHERM_00313730(gene)
ATGGATACTGCTCATAAAACAGTAAACGAAAAGAAAGAATACTTTGATTCTCCGGAATTA
TTAGAAGCAAAAGTCACTTAGTTGGCAGATATGATTAAATAGTCAAATCACTTTGTTTGC
TTTACAGGTGCTGGAATATCTACTTCAGCAGGTATAGCTGATTTTAGAAGTGGAGTTAAC
ACAGTCTTGAAAACTGGACCTGGTTTGTGGGAAAAGATGGCTTAAAAAGTAGGAAATCAA
CCTAAAAAACACAAAGTTATAATGTCTAGAGCTGTTCCAACTAAAAGCCATATGGCACTA
GTTAAGTTGAATCAAGAAGGAATTCTTAAGTATTTAATCAGTTAAAATATAGACGGCTTA
CATAGAAGAAGTGGATTCAACCCTAATAGCCTATCTGAACTACATGGAAACACTAATTTA
GAGAAATGTTTAAAATGTGGAAAGTCTTATATGAGAGATTATAGAGTGAGAAAAGCTTTA
GATGTTCATGACCACTTAACAGGAAGGATTTGCGACAATTAGAAATGTGGTGGCGAATTA
GTAGATACAATTGTTAATTTTGGAGAGAATTTACCCAAAAAAGATATGGAATAAGGTTTT
TTTAACTCAAAATAAGCAGATTTACACTTAGTTTTAGGAAGTAGTTTAAGAGTTACTCCA
GCAGCTGATATGCCTCTAGCAACTGCTTAAAATGGAAATAAATTAGTTGTGGTTAATTTA
CAAAAAACCCCTCTAGATAGCTTGTGTGCCTTAAGAATATATGCTTTGATTGATGATGTC
ATGGTTCTACTTATGAAAAAGCTAGGTTTAGAGATACCAGAATTTATTCTGCAGAGAACT
ATTGTGATTAAAAAGACAAACTAAAATACAATAAACGTTTTTAGTGAAGACAAAGATGGT
TGTCCATATGACATTTTTAAGTAAATTGTTTTGGATTAAGGCAAAAAGTAACCATTTGAG
ATTTAGGTTAAAGCACCTTACATATTCAATATCACAAATCCATAATTTGCCATAAAGCTA
GGATTTTTTGAACATTATAAAGAAGGACCATTCAGATTAGATTTAAATTTATAAAATCTA
CCTCTTGGATAAAAGACTAAGTATTTAATATAATTCTCACCAAAATTACAAAAGTGGATT
AGTTGTGAAAAAATATAATGA