Identifiers and Description

Gene Model Identifier

TTHERM_00647330

Standard Name

THD1 (Tetrahymena Histone Deacetylase 1)

Aliases

PreTt15839 | 93.m00135 | 3727.m00055

Description

Histone deacetylase; homolog of yeast Rpd3p; localized to the macronucleus during vegetative growth; deacetylates all four core histones in vitro; knockdown cells exhibit extrusion bodies and reduced phosphorylation of histone H1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF04702 ) Vicilin N terminal region
  • ( PF00850 ) Histone deacetylase family
  • ( PF02134 ) Repeat in ubiquitin-activating (UBA) protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00647330

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_75270
Tetrahymena borealisEI9_18837.19.997093137033517e-262histone deacetylase (730 aa)
OxytrichaContig1672.0.g150.000000005997038937208364Myb-like DNA-binding domain

General Information

Paragraph NoGene NameParagraph Text
12THD1THD1, a homolog of the Saccharomyces cerevisiae Rpd3p, a class I histone deacetylase (HDAC), is localized to the macronucleus during vegetative growth, and distributed to developing new macronuclei early in their differentiation. Thd1p deacetylates all four core histones in vitro. Thd1p is a 52kDa polypeptide in an HDAC complex of approximately 160 kDa.
13THD1Tetrahymena cells with reduced Thd1p expression exhibited phenotypes indicative of loss of chromatin integrity, such as DNA fragmentation and extrusion of chromatin from the macronucleus, variable macronuclear size and shape, enlarged nucleoli, and reduced phosphorylation of histone H1 from bulk chromatin. Macronuclei in THD1 knockdown cells also contained more DNA, suggesting Thd1p may play a role in regulating macronuclear DNA content. The THD1 gene could not be completely replaced by a disruption construct, suggesting that THD1 is an essential gene.

Associated Literature

  1. Ref:18178773: Smith JJ, Torigoe SE, Maxson J, Fish LC, Wiley EA (2008) A class II histone deacetylase acts on newly synthesized histones in Tetrahymena. Eukaryotic cell 7(3):471-82
  2. Ref:17715364: Parker K, Maxson J, Mooney A, Wiley EA (2007) Class I histone deacetylase Thd1p promotes global chromatin condensation in Tetrahymena thermophila. Eukaryotic cell 6(10):1913-24
  3. Ref:15879532: Wiley EA, Myers T, Parker K, Braun T, Yao MC (2005) Class I histone deacetylase Thd1p affects nuclear integrity in Tetrahymena thermophila. Eukaryotic cell 4(5):981-90
  4. Ref:11046129: Wiley EA, Ohba R, Yao MC, Allis CD (2000) Developmentally regulated rpd3p homolog specific to the transcriptionally active macronucleus of vegetative Tetrahymena thermophila. Molecular and cellular biology 20(22):8319-28

Sequences

>TTHERM_00647330(coding)
ATGAATTAAAATACTCATACTTATGAAGAGAGTCCATCTTTTTAGGATTCTTTTATAGAT
TAACAATAATAAATTAAGAGTAATTTATCTCTTCATACATTGCAACCAAACGATACTTTT
CATGCTGAATACTAAACTCAGAATCCTCCCTCTTTTCAGGAAAAGAATCTATTTATTAAC
TAGTTAAATACCAATGAATACAGTCATGATAACTTTGAAGTTGATTAAGTAACAGGAGAG
TAAGACTATTTAAATGATGGTGAAAATAACACTAGAAATTATACTATAAATTACAATCAT
GTAGAAAATAATTAAGATGAAGATGATGAAATATACGCTGATTACTTGCCTGAAAATTTC
TTTGAGCAATTAAAACCGAACCCAAGCTAATTTACAATGAATTTTAATTAGAACACTAAA
AAAAAGGAAGAAAGAAAATCCATAAATAATCGTTCAACTTCTCTTAAAAAAAGAATAGAA
TAAAAAAATGATGAGATGTTATACACTAGAGCCGCCAAGTAGTAAATATGCCAAAACCTC
GTTTAGCAATAGATTGATAAAGAAATCAAATACATGTCTAATGCAAAAAAAATGAGCCAA
AATAGCTATAGAATAGTGGCAAAAAAATTAGAAAATGTAATATCTTCAAAAATGGCAGAA
ATTGACCCCTCTTTGAGTAAAATATTGACATTTTCTCAAGTAGGCAGATTATTCTAGCTG
CTTGATTTATTCACTGTAGTTAAATTTGATGAAAACTCATAAATCATCATCGAATAAAAT
ATAGATCCTCATAAAAAACTTAGATTTGCCCAAGAAACAATGTTTCACCAATAATTTTGG
TTTTTTGTTGTGAATTATATCAATAAAGAGACTGTATTGGGAGAAATAGTTTTTTCTACT
CTGAGAATATTGATGGATCCAATGCAATTAACGATTAAAGAAACTAAAGATTTCTTAGCT
TAGTATATGGGTAGGACACTTACATATTTAGAAGAAGATAGAAAAGCTGCTTAAGAGAGA
ACATAAGGATTTTAGCTCTGGAGCGTTGACGAAATTATCAAGGCATTTCGCTAGATTAAT
GAATAAAGAATTTTAAGGGAAAAGTCTTAAAACATAAATAATATTAATAATGTAAATAAA
AATAAAGCAAGCAATAAAGATTTAGATAAAAATATTTATACTTTCAAACCAACAATTGAT
AAAAACTCTTAATTAATTGATGAAATGCATAGGAAAAAATTTGCTATGGCATCTAGTGGA
CTAAATATCACTCCTATTAGACATTCAAATGCAACACAAAACACAAAGAGTATACAAAGT
ACTAATAAACTTATAAATTTACTCTAATCTTCCTAAAGTAACTAGAATCTGCATTCTTAA
GCTAGTATTTTACTCTAACAGTAAATGAATTAAACTCTGATCAATAATTAAAGCAATACA
AATAATTTGAATCACAACAGCAGCTCTTTGAGTTTTTTAAATAATACAAATAATTAAGTT
AATTAACACCCTAACATGAATTACAACGAAAATAATTCTACAACTACTAATGCTACAAGT
GACTATAGAAGCACTACTATGAATACTGATGTGGCTAATAATAGCTCTGAAAATTCATAA
AGAAACAGTGATAAATTTCTTTCTTAAAAAGTTAAATCTCTACTTTCTCAGCATTAGCAT
CCTTCTAGAACGAATTTAAATACAAACAATTAAAATTTTAACACTTTGTAGCACAATAGT
CATAATAATAACAACCAAAATGGCTAAATTGGAATGAGTGAATATGATCATGAAGATCCT
TAGAGCTACTTCTCAAAAATTAAAAGATGTGCTACATTAAGCAGTTTCTAAATTCCAGAG
GAAGATTATATAGAAGATATTAGCCACATTCCTTCAAATAATTTTGAAAAACCAATAGAT
AGAGTCAACATGATGCTATAGAAGTAGCAGCAAACCTAGAGAAAAATCAGTTAAAAAAAG
GAACAAATAATTTAGGAACAAATGAAGGAATGTACTTTTAAACCATAACTTCAAAGAAGT
GTTTCTCCTTAATACTCTGCATATTCTAGAAATCAAAAAGAATTATTACAAAGACAGTAG
CATGATATAAACAAAAGATAGTAAGCAGCAGAATAAAGAAATAGATAAAAGTAAGAATAT
GAAGAAAAACTATTAAATGAATGTACATTCTAACCTTCGTTATCTCCTTCTTAAAGGCTC
ATTAACAAAACAAGTAAATCACCAGTTTCACCTAAAGGGTTTGAATAAACTGTTCATAGA
ATGAGAGCTGCTTAGGATATTTAGCGTTAAAGCAGAAAAGCTTTTGATTAAGGATCATAT
AGCTCGAATGCCTAAATAGTAAGAAATTCTGTTGTTAGAAATTCATTAAGTCCAAATGTT
GAAATTAATAAATAAATTTAGATATAATAAAGCTTTTAGAAGCAAAATCCTTCTTAATAG
CAAGAACAATACTTATAATAAGTAAATTAACAAAAATAAATTTAATAAGATTTTTCAGAA
GATTTAGAAGGAGATATGCTACAATAATAACCATAATAAGAAAAATAATAATTTTACTAG
ATATATGAAAACTAAAATTAAAGTGCAAATCAAATGCATTAATAAAAATAAAGCATAGTT
GAAAAAGAAAACGAACAAAGATTAGATTTAGAAAACTAATTCATTAATGACTAATAAAGT
TTTGTAGAGAAAATAACAAATAAATAAAAACCTAATTTTTAAGATTAAACATTTGGAGAT
TCATAAAAGAAAAACCAATAATTAGAAATTTATTAAAAACCAAAAGCTAAGCCATTTTTT
GTGCTAGATATTATTACACCAAAAGGAGAGAAAGCAGCTTTAGAACTATTTAAGGATGAT
GATATTTACCAAAAAGCTGAAGTATTCTCTTAACAATATTAATTAGACGAAATTACATAA
AGTAAAATAGAATAGATCCTAGATTAGCAAATGCAAAAATATCTCTTAAAAAAATAAAAC
ACTGTAAAAAATAATTGA


>TTHERM_00647330(protein)
MNQNTHTYEESPSFQDSFIDQQQQIKSNLSLHTLQPNDTFHAEYQTQNPPSFQEKNLFIN
QLNTNEYSHDNFEVDQVTGEQDYLNDGENNTRNYTINYNHVENNQDEDDEIYADYLPENF
FEQLKPNPSQFTMNFNQNTKKKEERKSINNRSTSLKKRIEQKNDEMLYTRAAKQQICQNL
VQQQIDKEIKYMSNAKKMSQNSYRIVAKKLENVISSKMAEIDPSLSKILTFSQVGRLFQL
LDLFTVVKFDENSQIIIEQNIDPHKKLRFAQETMFHQQFWFFVVNYINKETVLGEIVFST
LRILMDPMQLTIKETKDFLAQYMGRTLTYLEEDRKAAQERTQGFQLWSVDEIIKAFRQIN
EQRILREKSQNINNINNVNKNKASNKDLDKNIYTFKPTIDKNSQLIDEMHRKKFAMASSG
LNITPIRHSNATQNTKSIQSTNKLINLLQSSQSNQNLHSQASILLQQQMNQTLINNQSNT
NNLNHNSSSLSFLNNTNNQVNQHPNMNYNENNSTTTNATSDYRSTTMNTDVANNSSENSQ
RNSDKFLSQKVKSLLSQHQHPSRTNLNTNNQNFNTLQHNSHNNNNQNGQIGMSEYDHEDP
QSYFSKIKRCATLSSFQIPEEDYIEDISHIPSNNFEKPIDRVNMMLQKQQQTQRKISQKK
EQIIQEQMKECTFKPQLQRSVSPQYSAYSRNQKELLQRQQHDINKRQQAAEQRNRQKQEY
EEKLLNECTFQPSLSPSQRLINKTSKSPVSPKGFEQTVHRMRAAQDIQRQSRKAFDQGSY
SSNAQIVRNSVVRNSLSPNVEINKQIQIQQSFQKQNPSQQQEQYLQQVNQQKQIQQDFSE
DLEGDMLQQQPQQEKQQFYQIYENQNQSANQMHQQKQSIVEKENEQRLDLENQFINDQQS
FVEKITNKQKPNFQDQTFGDSQKKNQQLEIYQKPKAKPFFVLDIITPKGEKAALELFKDD
DIYQKAEVFSQQYQLDEITQSKIEQILDQQMQKYLLKKQNTVKNN


>TTHERM_00647330(gene)
ATGAATTAAAGTAACTTCATTTTTGGAAGAAAAAGCTTTATTTAATCTTTAATCATTTAA
ACTATTTGAAAGATACTCATACTTATGAAGAGAGTCCATCTTTTTAGGATTCTTTTATAG
ATTAACAATAATAAATTAAGAGTAATTTATCTCTTCATACATTGCAACCAAACGATACTT
TTCATGCTGAATACTAAACTCAGAATCCTCCCTCTTTTCAGGAAAAGAATCTATTTATTA
ACTAGTTAAATACCAATGAATACAGTCATGATAACTTTGAAGTTGATTAAGTAACAGGAG
AGTAAGACTATTTAAATGATGGTGAAAATAACACTAGAAATTATACTATAAATTACAATC
ATGTAGAAAATAATTAAGATGAAGATGATGAAATATACGCTGATTACTTGCCTGAAAATT
TCTTTGAGCAATTAAAACCGAACCCAAGCTAATTTACAATGAATTTTAATTAGAACACTA
AAAAAAAGGAAGAAAGAAAATCCATAAATAATCGTTCAACTTCTCTTAAAAAAAGAATAG
AATAAAAAAATGTAAACTGATACTTTTGTGTTTTAAACCTCTATCAAATCGCAATTTTAA
TATAATTTTTGATTAATAATATCTCACTTTTACTAACATAAAATAAGGATGAGATGTTAT
ACACTAGAGCCGCCAAGTAGTAAATATGCCAAAACCTCGTTTAGCAATAGGTAATGAAAA
TTTTTATAATTTCATTGACATATAAAATATTATTTGAAGCTCTATTTTTAGTTACTGATT
TTCATTTTATAAAAGATTGATAAAGAAATCAAATACATGTCTAATGCAAAAAAAATGAGC
CAAAATAGCTATAGAATAGTGGCAAAAAAATTAGAAAATGTAATATCTTCAAAAATGGCA
GAAATTGACCCCTCTTTGAGTAAAATATTGACATTTTCTCAAGTAGGCAGATTATTCTAG
CTGCTTGATTTATTCACTGTAGTTAAATTTGATGAAAACTCATAAAGTATTAATTTAATT
GATTTATTTTTATTATTATTATAATTATTCATTTGCATCTTTTGCATAAATATCAACAAC
CACCAAAACCCTTTAATTAAGTTTTTAACGAATTTCTTAATTTTGCGAAAATATCTTCAT
TTATTCTTTCATTGATAAATTCGTTTGCATTTTCTTTTGCGCAATGTTAAATACAGATAA
CTACAATTTATTAATATTTCAAACTGAAATTGTGCTAAAAAATCACATTTTTTATTTCAA
TTATTCTATCAGTTAAATTAGAATACTTCAAAGTAAATATTTTTAATTTATATTTAAAAA
ATTAGTCATCATCGAATAAAATATAGATCCTCATAAAAAACTTAGATTTGCCCAAGAAGT
AAGAATAATTTTTAATTATTTTATTTTTTCTAATCAATTTATTTTCATTTTTTGACAAAA
ATTTTTCATTTATTTTGGTTTAATCTTTTAATTAAATATTAAATTTATTTTAAATAACTT
CCATTCAATTATTTAGATAAATAACTAAATAAAAACTAAAAAATCTTTTTATTTTTTCTT
TTAAGATAGATTATTTAGATTAATTTTTTATTTCTTTCAAAAAAAATTGTTAAATATGAA
AGATATTTTTGTTTAATTTAAAAAACAAATTTATTAAATTATTTTCAATATCTTTACTTA
ATTTAACAAAATGAATAAAATTTTTTATTTTAATTTTGATTGAAAAATATTTTTTCATTG
ATTTTTAATAAAATTAATTATTTGCTATTTTAATTTTATAGACAATGTTTCACCAATAAT
TTTGGTTTTTTGTTGTGAATTATATCAATAAAGAGACTGTATTGGGAGAAATAGTTTTTT
CTACTCTGAGAATATTGATGGATCCAATGCAATTAACGATTAAAGAAACTAAAGATTTCT
TAGCTTAGTATATGGGTAGGACACTTACATATTTAGAAGAAGATAGAAAAGCTGCTTAAG
AGAGAACATAAGGATTTTAGCTCTGGAGCGTTGACGAAATTATCAAGGCATTTCGCTAGA
TTAATGAATAAAGAATTTTAAGGGAAAAGTCTTAAAACATAAATAATATTAATAATGTAA
ATAAAAATAAAGCAAGCAATAAAGATTTAGATAAAAATATTTATACTTTCAAACCAACAA
TTGATAAAAACTCTTAATTAATTGATGAAATGCATAGGAAAAAATTTGCTATGGCATCTA
GTGGACTAAATATCACTCCTATTAGACATTCAAATGCAACACAAAACACAAAGAGTATAC
AAAGTACTAATAAACTTATAAATTTACTCTAATCTTCCTAAAGTAACTAGAATCTGCATT
CTTAAGCTAGTATTTTACTCTAACAGTAAATGAATTAAACTCTGATCAATAATTAAAGCA
ATACAAATAATTTGAATCACAACAGCAGCTCTTTGAGTTTTTTAAATAATACAAATAATT
AAGTTAATTAACACCCTAACATGAATTACAACGAAAATAATTCTACAACTACTAATGCTA
CAAGTGACTATAGAAGCACTACTATGAATACTGATGTGGCTAATAATAGCTCTGAAAATT
CATAAAGAAACAGTGATAAATTTCTTTCTTAAAAAGTTAAATCTCTACTTTCTCAGCATT
AGCATCCTTCTAGAACGAATTTAAATACAAACAATTAAAATTTTAACACTTTGTAGCACA
ATAGTCATAATAATAACAACCAAAATGGCTAAATTGGAATGAGTGAATATGATCATGAAG
ATCCTTAGAGCTACTTCTCAAAAATTAAAAGATGTGCTACATTAAGCAGTTTCTAAATTC
CAGAGGAAGATTATATAGAAGATATTAGCCACATTCCTTCAAATAATTTTGAAAAACCAA
TAGATAGAGTCAACATGATGCTATAGAAGTAGCAGCAAACCTAGAGAAAAATCAGTTAAA
AAAAGGAACAAATAATTTAGGAAGTAAATTAATTTACTAATAATTAATTAATTATTTACT
AATTAAATATTTTAAAGCAAATGAAGGAATGTACTTTTAAACCATAACTTCAAAGAAGTG
TTTCTCCTTAATACTCTGCATATTCTAGAAATCAAAAAGAATTATTACAAAGACAGTAGC
ATGATATAAACAAAAGATAGTAAGCAGCAGAATAAAGAAATAGATAAAAGTAAGAATATG
AAGAAAAACTATTAAATGAATGTACATTCTAACCTTCGTTATCTCCTTCTTAAAGGTTTT
TCATTGATTTTTTTCTGAATTTTTAAAATTAAAATGAAATAAATGTGAATTTATTTATTT
ATGTATAGGCTCATTAACAAAACAAGTAAATCACCAGTTTCACCTAAAGGGTTTGAATAA
ACTGTTCATAGAATGAGAGCTGCTTAGGATATTTAGCGTTAAAGCAGAAAAGCTTTTGAT
TAAGGATCGTAATTAAAAAATTTAGATTTATTAAAATGAATAAATTGTTTATTATTATTT
ATTTATATTTAATTTTTAATAAATTTACTTAATTTAAACTCAAATTAAATTTTAGATATA
GCTCGAATGCCTAAATAGTAAGAAATTCTGTTGTTAGAAATTCATTAAGTCCAAATGTTG
AAATTAATAAATAAATTTAGATATAATAAAGCTTTTAGAAGCAAAATCCTTCTTAATAGC
AAGAACAATACTTATAATAAGTAAATTAACAAAAATAAATTTAATAAGATTTTTCAGAAG
ATTTAGAAGGAGATATGCTACAATAATAACCATAATAAGAAAAATAATAATTTTACTAGA
TATATGAAAACTAAAATTAAAGTGCAAATCAAATGCATTAATAAAAATAAAGCATAGTTG
AAAAAGAAAACGAACAAAGATTAGATTTAGAAAACTAATTCATTAATGACTAATAAAGTT
TTGTAGAGAAAATAACAAATAAATAAAAACCTAATTTTTAAGATTAAACATTTGGAGATT
CATAAAAGAAAAACCAATAATTAGAAATTTATTAAAAACCAAAAGCTAAGCCATTTTTTG
TGCTAGATATTATTACACCAAAAGGAGAGTAATTTAAAAAAACCATTTCAAATAAAACAA
ATAAGTTATTTAATTATTTAAAAATAGGAAAGCAGCTTTAGAACTATTTAAGGATGATGA
TATTTACCAAAAAGCTGAAGTATTCTCTTAACAATATTAATTAGACGAAATTACATAAAG
TAAAATAGAATAGATCCTAGATTAGCAAATGCAAAAATATCTCTTAAAAAAATAAAACAC
TGTAAAAAATAATTGA