Identifiers and Description

Gene Model Identifier

TTHERM_01008630

Standard Name

THC1 (Tetrahymanol cyclase)

Aliases

PreTt29567 | 194.m00023

Description

Metabolic enzyme involved in triterpenoids biosynthesis; catalyzes the formation of tetrahymanol from squalene by a direct cyclization. (US PATENT 7105324 B2, 2006)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF01753 ) MYND finger
  • ( PF07966 ) A1 Propeptide
  • ( TIGR01507 ) squalene-hopene cyclase
  • ( PF01473 ) Putative cell wall binding repeat
  • ( TIGR00072 ) hydrogenase maturation protease
  • ( TIGR01787 ) squalene/oxidosqualene cyclases
  • ( PF07678 ) A-macroglobulin complement component
  • ( PF06571 ) Protein of unknown function (DUF1130)
  • ( TIGR00255 ) conserved hypothetical protein TIGR00255
  • ( PF00432 ) Prenyltransferase and squalene oxidase repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 92.2%

TetraMine Data

TTHERM_01008630

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13560.19.997093137033517e-262hypothetical protein (656 aa)
DictyBaseDDB_G02692265.997612587164444e-16cas1 on chromosome: 1 position
3476704 to 3479389
SGDYHR072W0.00000000002000577768187062ERG7 Lanosterol synthase, an e
ssential enzyme that catalyzes
the cyclization of squalene 2
,3-epoxide, a step in ergoster
ol biosynthesis

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01008630(coding)
ATGAAGAAGATACTCATAGGCTTAATTATAGGTCTCTTTTTATTCTCAAGCGTTAATGCC
AGCGTTAATCTCACTGAAGTCTAAAATGCCATCTCTATCTAGCAAGGCATTAATTGGGCA
GAAGTACACAACAATACTTGGTACTATCCTCCTTACTTAGGCGAAATGTTTATCAGTGAA
TACTACTTCGAGTTACTCGTCTTGAATTGGACTCATAAATCTGCTTTCAACGCTACATAC
TTTACAGAACGTCTCCTCTAGACTTAATTCGAAGATGGTTCATGGGAGCAAGTCAGAGAA
CAAAATCTTGAAACTGGTTAGTTAGATGCTACTGTCTTTAACTACTGGTACTTAAAGTCT
ATTAACAACAATCCTAAAATTGAAGCTGCTCTATAAAAGGCTAGAAAATGGATAGTTGCT
TAGGGTGGTATTGAAGCAACTCAAACAATGACCAAGTTTAAGTTAGCAGCCTTCGGTTAA
TACAGTTGGGAAGATTTATGGTATGTCCCATTGTTCATCTTCAAGTAGAATGGAATTTTC
AAATATACCTACGTTAAGGATATTGTTGCATAATGGGTCTATCCACATTTAACTGCCTTA
GCTTATTTGCGTTACTAAAGAACTGTTTTCAATGTTCCTGTTGCTGATTTGAGAGAGCTC
TGGATCAATTACCCTAAGAACGGTATTAAAATCAGTCCAAGAGAATACTCTACACTTAAT
CCTGATAGCGATCTCTTGATCTTAATGGACGAAATCTTCAAACTTAAACAACCTCTTGGA
AGTTTCGGTGCCTACACTATTTCAACCCTCTTGACTTTAATGTCCTTCAAAGACTTTTAG
TCAAAGCACCCTCATCTATACCAAAACGAAATACAAAAGGCTTACGAAGACGGATACTAT
TTCGTTGAGTTTAACTACTTTAACTTTAGAGAAGCTTATCACGGCTCTTTGGATGATGGT
AGATGGTGGGATACCATTCTTATTAGTTGGGCTATGCTTGAAAGTGGCTAAGATAAAGAA
AGAATCTTCCCTATCGTATAAAATATGGTCAAAGAAGGTCTTTAACCTAAAAAAGGTATA
GGTTATGGATATGATTTCGAATATGCTCCTGACACTGATGACACTGGATTACTTCTCGTT
GTTATGAGTTACTACAAAGAAGCCTTCTAAAAGTAAATCCCTGAAACTATTGAATGGCTT
TTCTCTATGCAAAATGACGATGGTGGCTATCCAGCTTTTGACAAAGGTAAAAATGAAGAC
AATTTATTGTTCAAGTTTGCCTTCAATATGGCTGGTATTGCTAACTCAGCTGAAATCTTC
GATCCCTCATGTCCTGATATTACTGGTCACATCATGGAAGGATTGGGTGAGTTTGGATAT
CAAGCTAATCATCCTTAGATTTAAAATATGATTAAATATCAAAGAAAGACTTAGAACAAG
TGGGGATCTTGGTAAGCTAGATGGGGTGTAAATTACATTATGGCTGTTGGAGCTGTTGTA
CCAGGTTTAGCAAGAGTCAATTACGACTTAAATGAACAGTGGGTACAAAATAGTATAAAT
TATTTGCTTAATAAATAAAATAAAGATGGTGGCTTTGGTGAATGTGTCCTTTCTTATAAT
GATCCTGAAAAGTGGAATGGTATAGGTAAATCTACTGTCACTCAAACCTCATGGGGACTA
TTAGCTCTTTTAGAAGTTTATAATTAAAATGAACAAATTAAGCATGCTGCAGATAGAGCT
GCTTAGTATTTATTAGATTAATTCAAAAGAGACGATAATACCTTCTATGATCACTCCACA
ATAGGAACAGGTCACAGAGGATTACTCTATTTATAGTACCCCTCATATGCACAATCATTC
CCATTAGTAGCTTTAAATAGATACTAAAAAATATCTCAAGGTTAATATCACTTCTCCAAA
AATTTGTACAATGGTAATGGAGAACCTGTATAAAAATAAAATATTTGA


>TTHERM_01008630(protein)
MKKILIGLIIGLFLFSSVNASVNLTEVQNAISIQQGINWAEVHNNTWYYPPYLGEMFISE
YYFELLVLNWTHKSAFNATYFTERLLQTQFEDGSWEQVREQNLETGQLDATVFNYWYLKS
INNNPKIEAALQKARKWIVAQGGIEATQTMTKFKLAAFGQYSWEDLWYVPLFIFKQNGIF
KYTYVKDIVAQWVYPHLTALAYLRYQRTVFNVPVADLRELWINYPKNGIKISPREYSTLN
PDSDLLILMDEIFKLKQPLGSFGAYTISTLLTLMSFKDFQSKHPHLYQNEIQKAYEDGYY
FVEFNYFNFREAYHGSLDDGRWWDTILISWAMLESGQDKERIFPIVQNMVKEGLQPKKGI
GYGYDFEYAPDTDDTGLLLVVMSYYKEAFQKQIPETIEWLFSMQNDDGGYPAFDKGKNED
NLLFKFAFNMAGIANSAEIFDPSCPDITGHIMEGLGEFGYQANHPQIQNMIKYQRKTQNK
WGSWQARWGVNYIMAVGAVVPGLARVNYDLNEQWVQNSINYLLNKQNKDGGFGECVLSYN
DPEKWNGIGKSTVTQTSWGLLALLEVYNQNEQIKHAADRAAQYLLDQFKRDDNTFYDHST
IGTGHRGLLYLQYPSYAQSFPLVALNRYQKISQGQYHFSKNLYNGNGEPVQKQNI


>TTHERM_01008630(gene)
ATGAAGAAGATACTCATAGGCTTAATTATAGGTCTCTTTTTATTCTCAAGCGTTAATGCC
AGCGTTAATCTCACTGAAGTCTAAAATGCCATCTCTATCTAGCAAGGCATTAATTGGGCA
GAAGTACACAACAATACTTGGTACTATCCTCCTTACTTAGGCGAAATGTTTATCAGTGAA
TACTACTTCGAGTTACTCGTCTTGAATTGGACTCATAAATCTGCTTTCAACGCTACATAC
TTTACAGAACGTCTCCTCTAGACTTAATTCGAAGATGGTTCATGGGAGCAAGTCAGAGAA
CAAAATCTTGAAACTGGTTAGTTAGATGCTACTGTCTTTAACTACTGGTACTTAAAGTCT
ATTAACAACAATCCTAAAATTGAAGCTGCTCTATAAAAGGCTAGAAAATGGATAGTTGCT
TAGGGTGGTATTGAAGCAACTCAAACAATGACCAAGTTTAAGTTAGCAGCCTTCGGTTAA
TACAGGTAAAGTTTCTTTTTCATCAATATTTTAGAAATAAACAATCAATTTTAAATTATT
CTCCCATATTTTGCTCAAATAATAATTTCTACTTAAATAATTAGCTTCAACTGCAAATAT
AAAAATGAATTAATTTATTATAAATAAAAGCAGTAAATATAAGCAAATATACTAATTTAA
TTAGCTTATTATTCTGTTAATATTTAAAAGCCATTTTGACTCAATAGCTTATTTTATTTT
AAATAATTAAATAGTTGGGAAGATTTATGGTATGTCCCATTGTTCATCTTCAAGTAGAAT
GGAATTTTCAAATATACCTACGTTAAGGATATTGTTGCATAATGGGTCTATCCACATTTA
ACTGCCTTAGCTTATTTGCGTTACTAAAGAACTGTTTTCAATGTTCCTGTTGCTGATTTG
AGAGAGCTCTGGATCAATTACCCTAAGAACGGTATTAAAATCAGTCCAAGAGAATACTCT
ACACTTAATCCTGATAGCGATCTCTTGATCTTAATGGACGAAATCTTCAAACTTAAACAA
CCTCTTGGAAGTTTCGGTGCCTACACTATTTCAACCCTCTTGACTTTAATGTCCTTCAAA
GACTTTTAGTCAAAGCACCCTCATCTATACCAAAACGAAATACAAAAGGCTTACGAAGAC
GGATACTATTTCGTTGAGTTTAACTACTTTAACTTTAGAGAAGCTTATCACGGCTCTTTG
GATGATGGTAGATGGTGGGATACCATTCTTATTAGTTGGGCTATGCTTGAAAGTGGCTAA
GATAAAGAAAGAATCTTCCCTATCGTATAAAATATGGTCAAAGAAGGTCTTTAACCTAAA
AAAGGTATAGGTTATGGATATGATTTCGAATATGCTCCTGACACTGATGACACTGGATTA
CTTCTCGTTGTTATGAGTTACTACAAAGAAGCCTTCTAAAAGTAAATCCCTGAAACTATT
GAATGGCTTTTCTCTATGCAAAATGACGATGGTGGCTATCCAGCTTTTGACAAAGGTAAT
TTAATATTGATAATTTATTCCATTTCTTTATTTAATAAAAATAAATCTTTTAATTATTTC
AATTGAAAGATACATTTAAATAAAATTACAAATGTACTTAAAATAAATATAATATTATTA
ACACTTCTACTTTATTTTAAAATAGGTAAAAATGAAGACAATTTATTGTTCAAGTTTGCC
TTCAATATGGCTGGTATTGCTAACTCAGCTGAAATCTTCGATCCCTCATGTCCTGATATT
ACTGGTCACATCATGGAAGGATTGGGTGAGTTTGGATATCAAGCTAATCATCCTTAGATT
TAAAATATGATTAAATATCAAAGAAAGACTTAGAACAAGTGGGGATCTTGGTAAGCTAGA
TGGGGTGTAAATTACATTATGGCTGTTGGAGCTGTTGTACCAGGTTTAGCAAGAGTCAAT
TACGACTTAAATGAACAGTGGGTACAAAATAGTATAAATTATTTGCTTAATAAATAAAAT
AAAGATGGTGGCTTTGGTGAATGTGTCCTTTCTTATAATGATCCTGAAAAGTGGAATGGT
ATAGGTAAATCTACTGTCACTCAAACCTCATGGGGACTATTAGCTCTTTTAGAAGTTTAT
AATTAAAATGAACAAATTAAGCATGCTGCAGATAGAGCTGCTTAGTATTTATTAGATTAA
TTCAAAAGAGACGATAATACCTTCTATGATCACTCCACAATAGGAACAGGTCACAGAGGA
TTACTCTATTTATAGTACCCCTCATATGCACAATCATTCCCATTAGTAGCTTTAAATAGA
TACTAAAAAATATCTCAAGGTTAATATCACTTCTCCAAAAATTTGTACAATGGTAATGGA
GAACCTGTATAAAAATAAAATATTTGA