Identifiers and Description

Gene Model Identifier

TTHERM_00405550

Standard Name

TGT2 (tRNA-guanine transglycosylase 2)

Aliases

PreTt12802 | 43.m00320 | 3713.m00142

Description

tRNA-guanine transglycosylases, various specificities family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01702 ) Queuine tRNA-ribosyltransferase
  • ( TIGR00071 ) tRNA pseudouridine synthase A
  • ( TIGR00430 ) queuine tRNA-ribosyltransferase
  • ( TIGR00449 ) tRNA-guanine transglycosylases, various specificities

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00405550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13947.19.997093137033517e-262tRNA-guanine transglycosylase
(404 aa)
DictyBaseDDB_G02834459.997975313387782e-28DDB_G0283445 on chromosome: 4
position 707432 to 708938
WormBaseWBGene000065670.0000000000000030004923591262316locus:tgt-2 Queuine tRNA-rib
osyltransferase subunit tgt-2
status:Confirmed UniProt:Q
9NEU3 protein_id:CAC51046.1
OxytrichaContig21753.0.0.g220.00000000000003999587784428659Queuine tRNA-ribosyltransferas
e

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00405550(coding)
ATGGCATACAAACCAAAAGTTTTAAAATCCCTAAAAAGTCCTGGGTTTTTTATGAACACA
AGAAAAGGAACTTTATACCAACTTACTAATCATAATTCAGAACCTTTAAATTTGAATCAC
TTGATTGTGTCTCAAAGTGACTTTATGCATTGCGAAAAGCTATTTGAAGTGTTAAAAGAA
CAAAATTAGTCTTTCAAGAGCTATATAGGTTTCTCAAAAGAAGAAGAGCCTAAGAAATTT
ATATATTTATCTCCTATCGATTACTATAAGCCTTAATAAACAATGGAAGCCACTTCAAAA
TCAGATACTATTAAACTTTATACTACAAGAGGAGGTTATTTCGAAGTTTCTGATGAATAG
TATTACAAAATTTCAAAAATGATTAACCCTGATATTATTGTCTCCCTTACTGAAATTCCT
ACAGGAAAAGGCAAAAAATCTCATAAAAGATCAGTTGAAAAAACAATCGGCTTCTTAGAC
AAAGCTATTTCTATTTTCAGACCCAAGTCTAATGGAAACAGCGATGAAAATGAAAATCAC
ACAGATAAGTCCACTTTGATATTTGGATCAATTGAAGGAGGACAATTTGACGAGTAAAGA
AAAGAATGTGTTTAAAAGACTCTTGAAAGAGATATTGATGGAGTGGTTCTTCATGGTACT
GAAAGTGCTGAAACTATTGAAGAAAAAGCTAGATAGATTGCTTTGACTATGGAATATTTA
GGTGAACATAAAGAGAGTTTATATACAGTATATTCATCTAAGGGAACTATCTAAGATATC
CTCTTGGGTGTTTCTCATGGTATAGATTATTTTGAAGTCGATTATCCCAATTAATTAGCA
CATTCTCACCAAGCTCTCAACTTAGATTTTGATAATAAAAACTATGCAGAAACCTAGTCT
CTCTCAAACGAAGAAATTTTAAATGCATTAAAAGTAAAGCAACCCAAAATTTTCAACATG
ACTGAATACGAAAAGTATAAAGAAAGTTTAATTGGATTCACTGATGGATGTTAATGCTAT
TCTTGTTAAAATCACACACAAGCTTATGTTGCTCACCTTATTAAATGCAAAGAATTAACA
GGAACTATCCTCATTACCATTCATAACATCCATCAATATAACATTCTATTTTAACAATTG
CAGGAAGCTGCTGAAAACTAGAAGTTATCTAACTACATTTCTTGGTTCATTAAAACTAAT
CTTATTTGA


>TTHERM_00405550(protein)
MAYKPKVLKSLKSPGFFMNTRKGTLYQLTNHNSEPLNLNHLIVSQSDFMHCEKLFEVLKE
QNQSFKSYIGFSKEEEPKKFIYLSPIDYYKPQQTMEATSKSDTIKLYTTRGGYFEVSDEQ
YYKISKMINPDIIVSLTEIPTGKGKKSHKRSVEKTIGFLDKAISIFRPKSNGNSDENENH
TDKSTLIFGSIEGGQFDEQRKECVQKTLERDIDGVVLHGTESAETIEEKARQIALTMEYL
GEHKESLYTVYSSKGTIQDILLGVSHGIDYFEVDYPNQLAHSHQALNLDFDNKNYAETQS
LSNEEILNALKVKQPKIFNMTEYEKYKESLIGFTDGCQCYSCQNHTQAYVAHLIKCKELT
GTILITIHNIHQYNILFQQLQEAAENQKLSNYISWFIKTNLI


>TTHERM_00405550(gene)
ATGGCATACAAACCAAAAGTTTTAAAATCCCTAAAAAGTCCTGGGTTTTTTATGAACACA
AGAAAAGGAACTTTATACCAACTTACTAATCATAATTCAGAACCTTTAAATTTGAATCAC
TTGATTGTGTCTCAAAGTGACTTTATGCATTGCGAAAAGCTATTTGAAGTGTTAAAAGAA
CAAAATTAGTCTTTCAAGAGCTATATAGGTTTCTCAAAAGAAGAAGAGCCTAAGAAATTT
ATATATTTATCTCCTATCGATTACTATAAGCCTTAATAAACAATGGAAGCCACTTCAAAA
TCAGATACTATTAAACTTTATACTACAAGAGGAGGTTATTTCGAAGTTTCTGATGAATAG
TATTACAAAATTTCAAAAATGATTAACCCTGATATTATTGTCTCCCTTACTGAAATTCCT
ACAGGAAAAGGCAAAAAATCTCATAAAAGATCAGTTGAAAAAACAATCGGCTTCTTAGAC
AAAGCTATTTCTATTTTCAGACCCAAGTCTAATGGAAACAGCGATGAAAATGAAAATCAC
ACAGATAAGGTAGATTGCTTACAATACTAAACTTAACAATTAATTTATTTTTAATTAGAG
CTAAAATTTACTGCTTTATTAAACTGTCTACATGCATACATAATATATAATATCACAAAT
ATCTTTTCTTTCCCAACTCTTTAGACATGTAAACAATCTATAAGATTATCCGCTTAAATT
TTTGTATAAAAATTGGCAATCACAAGATTCATAGATGCAATAAAACTATAACATAATTTT
AGTGGAAATATTCAAAATAGAAAAAAATAATGATTTTCTCTTGAATATTTTAAGTTAAAG
AAAAACAAATAAAAATACACTAAATATTTTTTAGTTAAAATTAATAAAATTTATTATAAA
TAATATAGTAATTTGATAAAAAAATAAATTCTTTTTTCAAATCATTCTTTTTAGAATTAA
TCAACTTTTTTTAATAAAGTCCACTTTGATATTTGGATCAATTGAAGGAGGACAATTTGA
CGAGTAAAGAAAAGAATGTGTTTAAAAGACTCTTGAAAGAGATATTGATGGAGTGGTTCT
TCATGGTACTGAAAGTGCTGAAACTATTGAAGAAAAAGCTAGATAGATTGCTTTGACTAT
GGAATATTTAGGTGAACATAAAGAGAGTTTATATACAGTATATTCATCTAAGGGAACTAT
CTAAGATATCCTCTTGGGTGTTTCTCATGGTATAGATTATTTTGAAGTCGATTATCCCAA
TTAATTAGCACATTCTCACCAAGCTCTCAACTTAGATTTTGATAATAAAAACTATGCAGA
AACCTAGTCTCTCTCAAACGAAGAAATTTTAAATGCATTAAAAGTAAAGCAACCCAAAAT
TTTCAACATGACTGAATACGAAAAGTATAAAGAAAGTTTAATTGGATTCACTGATGGATG
TTAATGCTATTCTTGTTAAAATCACACACAAGCTTATGTTGCTCACCTTATTAAATGCAA
AGAATTAACAGGAACTATCCTCATTACCATTCATAACATCCATCAATATAACATTCTATT
TTAACAATTGCAGGAAGCTGCTGAAAACTAGAAGTTATCTAACTACATTTCTTGGTTCAT
TAAAACTAATCTTATTTGA