Identifiers and Description

Gene Model Identifier

TTHERM_00494100

Standard Name

TGT1 (tRNA-guanine transglycosylase 1)

Aliases

PreTt04247 | 61.m00234 | 3711.m00081

Description

queuine tRNA-ribosyltransferase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF03716 ) WCCH motif
  • ( PF01702 ) Queuine tRNA-ribosyltransferase
  • ( TIGR00430 ) queuine tRNA-ribosyltransferase
  • ( TIGR00449 ) tRNA-guanine transglycosylases, various specificities

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00494100

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13009.19.997093137033517e-262queuine tRNA-ribosyltransferas
e (430 aa)
OxytrichaContig21753.0.0.g221.0000297864968827e-159Queuine tRNA-ribosyltransferas
e
DictyBaseDDB_G02918022.9992103642374242e-151qtrt1 on chromosome: 6 positio
n 770747 to 772090
WormBaseWBGene000065662.0001701965494945e-132locus:tgt-1 Probable queuine
tRNA-ribosyltransferase sta
tus:Confirmed UniProt:Q23623
protein_id:CAA98076.1
Stentor CoeruleusSteCoe_135071.4788975056432133e-74

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00494100(coding)
ATGCAAAGTTATGCAAAATCTAAAAAAAAATTAATTAAACACTCCAAGAAGGATAATAAT
ATTAAAAGGCTTATCATTAAAAATTAGCTAAATAAATAAAAACTTATTAATTTATTTTGT
ATATAGTTAGATTATATGGATAATCAAGACTCTAAAGTCGAATAATTAGGTTAATCTGAG
AATTTTGGAGAAAATCCAGTTAAAAAATTAAAGACTGAATCTCTTAGCATGAACAAGGCT
TTAAAATTCGTAGTTCACAAAACATGTAACAAAGCAAGGGCATCTACCCTTACATTACCT
CACGGTGAAGTTTTAACTCCTGTTTATATGCCAGTAGGAACAAAGGGTACTATAAAGGGA
TTAACATCCTAAGAAATGGAAAATCTTGGTTGCAGATTACTTCTAGGTAACACATACCAT
CTTGCTTACTAGCCTGGTGGAGATTATTTAGAAAAAGTTGGTGGTTTGCATAAGTTTATG
AATTGGAAATATAATATTTTGACAGATTCTGGTGGTTTTTAAATGGTTTCACTTTCTAAA
TTATGTGAAATTTCTGAAGAAGGTGTAAAGTTTGAATCACCAGTTGATGGATCTGAAATG
TTTTTAAGACCTGAAGATTCTGTTCATAATTAGAATTAAATTGGAGCTGATATAATGATG
GCTCTTGATGATGTAGTATAAACAACAACTGTAGGAGAAAGAATGAAAATTGCATGTGAA
AGAACAGTCAGATGGATTGATAGAAATATTTAAGCTCATGAAAGAAAAGAAGTTTAAAAT
CTTTACCCTATCGTATAAGGCGGTTTAGATTTTGGCTTGAGAAAATACTGTTTAGATGAA
TTAATTAAAAGAGATGCTCCAGGATACGCTATAGGTGGTTTAGCAGGAGGAGAAGACAAA
TAAGATTTTTGGAAGATAGTCAATTTTTGTACAGATCACTTACCATAAGATAAGCCAAGA
TATCTTATGGGAGTTGGATATCCTGATGATTTGATTGTTTGCTCATGTTTAGGTGTTGAT
TAGTTTGACTGTGTTTTCTCTACAAGAACTGCAAGATTTGGAACTGCTTTTACTAAGTAT
GGATTTATGAGATTAAAAAATGCTGATAAAGAATTCGACCTTAAGCCTATTGAAGAAGGC
TGTGAATGTCCAACTTGCCAAAGATATTCAAGATCATTCCTTCACAATACTATAGCCAAG
GAAGAAACTGCTTGTCATTTGATTTCATAGCACAATTTATATTTCTTACTAAATTTGATG
AAATAATTTAGACAATCAATTTTAGATGGTAGAATGGAAGAATTTGTTAATGAGTTCTTT
AAAAACTATTTCAGCCATGAAAAGTAAATTCCATAGTGGATACAAGATGCTATGGTTGCT
GCTAAGATAAACTTAAATATAAAATTTGATGAGTGA


>TTHERM_00494100(protein)
MQSYAKSKKKLIKHSKKDNNIKRLIIKNQLNKQKLINLFCIQLDYMDNQDSKVEQLGQSE
NFGENPVKKLKTESLSMNKALKFVVHKTCNKARASTLTLPHGEVLTPVYMPVGTKGTIKG
LTSQEMENLGCRLLLGNTYHLAYQPGGDYLEKVGGLHKFMNWKYNILTDSGGFQMVSLSK
LCEISEEGVKFESPVDGSEMFLRPEDSVHNQNQIGADIMMALDDVVQTTTVGERMKIACE
RTVRWIDRNIQAHERKEVQNLYPIVQGGLDFGLRKYCLDELIKRDAPGYAIGGLAGGEDK
QDFWKIVNFCTDHLPQDKPRYLMGVGYPDDLIVCSCLGVDQFDCVFSTRTARFGTAFTKY
GFMRLKNADKEFDLKPIEEGCECPTCQRYSRSFLHNTIAKEETACHLISQHNLYFLLNLM
KQFRQSILDGRMEEFVNEFFKNYFSHEKQIPQWIQDAMVAAKINLNIKFDE


>TTHERM_00494100(gene)
AATTAATGCAAAGTTATGCAAAATCTAAAAAAAAATTAATTAAACACTCCAAGAAGGATA
ATAATATTAAAAGGCTTATCATTAAAAATTAGCTAAATAAATAAAAACTTATTAATTTAT
TTTGTATATAGTTAGATTATATGGATAATCAAGACTCTAAAGTCGAATAATTAGGTTAAT
CTGAGAATTTTGGAGAAAATCCAGTTAAAAAATTAAAGACTGAAGTAATCATTTAAAATA
TTTTAGCAACATTAAAAGCATAAAATAGTTTTTAGTCTTTAACTTTATAGCTTATCTTTA
GAACATCTAACATTATTTATAATTAATAATTTAGTCTCTTAGCATGAACAAGGCTTTAAA
ATTCGTAGTTCACAAAACATGTAACAAAGCAAGGTAAATAAATATTAAAAGATGTCTACA
AGTTATAACAAATAAATTAAATGAAATTTTCTATAAAATTAGGGCATCTACCCTTACATT
ACCTCACGGTGAAGTTTTAACTCCTGTTTATATGCCAGTAGGAACAAAGGGTACTATAAA
GGGTAAATATATATAAATTCTTTAATTTTTTTGATGAAAATGAAGGAAAATAATTATATT
TTTTGGATTAATTTAAAAGGATTAACATCCTAAGAAATGGAAAATCTTGGTTGCAGATTA
CTTCTAGGTAACACATACCATCTTGCTTACTAGCCTGGTGGAGATTATTTAGAAAAAGTT
GGTGGTTTGCATAAGTTTATGAATTGGAAATATAATATTTTGACAGATTCTGGTGGTTTT
TAAATGGTTTCACTTTCTAAATTATGTGAAATTTCTGAAGAAGGTGTAAAGTTTGAATCA
CCAGTTGATGGATCTGAAATGTTTTTAAGACCTGAAGATTCTGTTCATAATTAGAATTAA
ATTGGAGCTGATATAATGATGGCTCTTGATGATGTAGTATAAACAACAACTGTAGGAGAA
AGAATGAAAATTGCATGTGAAAGAACAGTCAGATGGATTGATAGAAATATTTAAGCTCAT
GAAAGAAAAGAAGTTTAAAATCTTTACCCTATCGTATAAGGCGGTTTAGATTTTGGCTTG
AGAAAATAGTAATTAATTTCTTAAATATTTCAGTTTAGCTTATCTTTTTAAGTAGATGCT
TTTATCTCTAAAATAAAGAATTTACTTTTTAATTACATTCTTATTCTTTTGTCCAATTAT
TGTCAAATATTAAGTTTGTTATTAAGTTAAATATGCCTAATTATTCGGTATTGTCAACTA
AAAAATATTTGAATTCAAAGATTATAAAATTATTTCGTTTTTTAATAAATATTTTATATA
AAGCTGTTTAGATGAATTAATTAAAAGAGATGCTCCAGGATACGCTATAGGTGGTTTAGC
AGGAGGAGAAGACAAATAAGATTTTTGGAAGATAGTCAATTTTTGTACAGATCACTTACC
ATAAGATAAGCCAAGATATCTTATGGGAGTTGGATATCCTGATGATTTGATTGTTTGCTC
ATGTTTAGGTGTTGATTAGTTTGACTGTGTTTTCTCTACAAGAACTGCAAGATTTGGAAC
TGCTTTTACTAAGTATGGATTTATGAGATTAAAAAATGCTGATAAAGAATTCGACCTTAA
GCCTATTGAAGAAGGCTGTGAATGTCCAGTAAAATATTATTTTATTTATTTATTTACTTA
CATTTGCTAATTTTGATGAAAACATAAAATAGACTTGCCAAAGATATTCAAGATCATTCC
TTCACAATACTATAGCCAAGGAAGAAACTGCTTGTCATTTGATTTCATAGCACAATTTAT
ATTTCTTACTAAATTTGATGAAATAATTTAGACAATCAATTTTAGATGGTAGAATGGAAG
AATTTGTTAAGTAAATATTTAAAAAATTTAATTATTCTCTAATTTTTCCTAATTTGTTAT
TAAAAGTGAGTTCTTTAAAAACTATTTCAGCCATGAAAAGTAAATTCCATAGTGGATACA
AGATGCTATGGTTGCTGCTAAGATAAACTTAAATATAAAATTTGATGAGTGATATAATTT
ATTAGTTGATGTATTATTATTTTTTTGTGATCTTTTAATGTAAATAGTAAATTAATTTAA
CGAAAATTAAATCTATCAATTATAATATTTTATTGTATGAACA