Identifiers and Description

Gene Model Identifier

TTHERM_00151600

Standard Name

TGS1 (Trimethyl Guanosine Synthase 1)

Aliases

PreTt20818 | 12.m00492 | 3700.m00212

Description

Trimethyl guanosine synthase; responsible enzyme for hypermethylation of guanosine 5' caps

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF08241 ) methyltransferase domain
  • ( PF08242 ) methyltransferase domain
  • ( TIGR02072 ) biotin biosynthesis protein BioC
  • ( TIGR00675 ) DNA (cytosine-5-)-methyltransferase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00151600

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05114.19.997093137033517e-262hypothetical protein (720 aa)
DictyBaseDDB_G02885470.00000000000007997998332353294DDB_G0288547 on chromosome: 5
position 1676407 to 1677541
OxytrichaContig19029.0.g570.000000000800327577657144RNA cap guanine-N2 methyltrans
ferase
SGDYPL157W0.000000100009565553302TGS1 Trimethyl guanosine synth
ase, conserved nucleolar methy
l transferase that converts th
e m(7)G cap structure of snRNA
s, snoRNAs, and telomerase TLC
1 RNA to m(2,2,7)G; also requi
red for nucleolar assembly and
splicing of meiotic pre-mRNAs
WormBaseWBGene000116310.0000009995106777214876status:Confirmed UniProt:A8W
HU4 protein_id:CAP19342.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000061

Sequences

>TTHERM_00151600(coding)
ATGTTTAATTGCTGTTTAAAGAATAATTAAAAGCATGACGATGATGATAACGGCAATAAA
AAAAAGGATAAAAGGCTAAAAAGTTAAATAAATATGAAGACAATCAACACTAATGATGAA
TCTATCTCTTAATTATAAGATACAAAACATTATACAAATAATTTAACAGTAACAAAGACA
GATATTTAGAATAATATGAATGCTAATACAGGAATACATAATTAATAAGGGTATATATCT
GAAAAAAGTATACTCTCTCATTTGAATAGTGAGAAGAAAAACCATAGAGACACAGTAGAA
ACACATAATAACAATAACAACAATTATAATAGCTTTTTTACTTCTGGTATGAATACTCCT
AATTATGACTATAATTTCAAAGGTTAAGATATCAATTAATCTGATAAAAAAGGCAATTAG
TAAGTAGCAACTGAGAAGGATAAAACAATTGCTTGTTCTTTAGATGCGAGTAATTTAGAG
CATTTTTAAAAAATTTTTGAAAAGAAGTAGGTAAAAGATTAGTAATTCGTGTAGCAAATA
GACCAGTAAGTAAAGCAAAGGTTTCTTTTGAATAAATTCTTTTTTTTGAGAGACTAAGGA
AATAAGTATGTTACTCTTGCTTATTGCAGTTATTAAGCTTTTTATGTTAATGGCGGGACA
TTTAATTATTCATTAGCGTCAAATAAGAGTACATAAAGTATCTTAAATAACACTAGTTTA
TTATTCAAAGCAGCTCCTAATTAGAATTTAAATGTTTCAAAGCAAATAAATACAAGCTAA
GATAGTATAAATTCTTAAAACAATTCTACTATCTTTACTACTAGTAAAGTACAAAATAAC
AATGTTGATTTTTTAAACTACTAAAGTCTATATGCAAAATTTAAAGTAGATATGGATTAG
ACTGAAAATTTCACACCTTAAAAAATAGCATTTCATATTGCCTAAAAATTTAAAAAATAC
CCTATCTTAATAGACGCCTGCTGTGGTATTGGAGGAAATACTGTGCAATTTTCCAAAATC
AATAAATTTGTTTTTGCTGTTGACTAGAGCTATAGAGCTATTAAAACATGCAATGAAAAC
ATAAAAAACCACAAATAAGATGTCTCAAATGTAGAATTCATTTAAGCAGATTTTTTATCA
TTAGAGTGTGGCGAGCTAGGCTAATTAAGAGCTGATATTGTATTCATAAATCCACAGATA
GATATGATTTCTGAAACAACAAAACCTGATATCTTTAAGCATTCTTCTCCTAATCTCTTA
AAAGCAATGAAAAATGCATACAGAATGTCAAAAAACATAGCTATTCTACTACCCTATTAC
ATAGATATAAACCAAATTCCTATATTATTGGATAAGTTTTATAGAATCTACAGAAATTTT
CCTTTAGACATGATTTAACATCACTGCCCTCACATAGAGATTATTTATATGAATGGAAAA
ATTAAGTATTTCTTGATTTTATTAGGTGACGCATCTAAGATATCTTAAGAAGATGAAATT
AAATTTCTCCAAGAGTACATATTAGATAATAGTCCATATAAAGGACCTTATGAAGAAAAA
GTGTTAGAGTTGTTAAATACTATATTAAGGAAAGTAGGTATGTTTAAATTAATTAGATGT
TTAGCTAAATCAATTGATATCAATGATCTTTAGAAGTAAAAAAATTTACTAAATTCTTTT
AGTGATGAATTAGAAAAAGAGGGCATTATCCATCAAAAAGAAATCAAAAATATGTTAAAT
TTAACAAACAATATTTCAAATGTTTGTGAAAGTGCTTCTGACTTAGTAGGGTCTCCAAAC
TAATTTCCAAACAGTTTCACATCTTAATAAAGCTTTTAGTTAAATGTTTAATAAGGTTCT
CTTGTATAATCTTAGGAATTAAATTAATAGTTACCAAAAGCTACTAGCTCAAAGTAAATA
TCATTTGATAAGGATTCATAAAGCAACTCATTTTATGGAGGAGGAGTAGAAAGCAGTCTC
GGAGATTTGTTAGAAAAAAAAGATAGCTTAAGTGAAAATGATATTTCTGATAATTACTCC
AATAATGAAAGTGATTTCTATTTCGATGAATATAATAACATTCCAATAGATGGAAATAAA
ATTAATTTAAATGTAAATAATCAAATAAAGTCAATTTGA


>TTHERM_00151600(protein)
MFNCCLKNNQKHDDDDNGNKKKDKRLKSQINMKTINTNDESISQLQDTKHYTNNLTVTKT
DIQNNMNANTGIHNQQGYISEKSILSHLNSEKKNHRDTVETHNNNNNNYNSFFTSGMNTP
NYDYNFKGQDINQSDKKGNQQVATEKDKTIACSLDASNLEHFQKIFEKKQVKDQQFVQQI
DQQVKQRFLLNKFFFLRDQGNKYVTLAYCSYQAFYVNGGTFNYSLASNKSTQSILNNTSL
LFKAAPNQNLNVSKQINTSQDSINSQNNSTIFTTSKVQNNNVDFLNYQSLYAKFKVDMDQ
TENFTPQKIAFHIAQKFKKYPILIDACCGIGGNTVQFSKINKFVFAVDQSYRAIKTCNEN
IKNHKQDVSNVEFIQADFLSLECGELGQLRADIVFINPQIDMISETTKPDIFKHSSPNLL
KAMKNAYRMSKNIAILLPYYIDINQIPILLDKFYRIYRNFPLDMIQHHCPHIEIIYMNGK
IKYFLILLGDASKISQEDEIKFLQEYILDNSPYKGPYEEKVLELLNTILRKVGMFKLIRC
LAKSIDINDLQKQKNLLNSFSDELEKEGIIHQKEIKNMLNLTNNISNVCESASDLVGSPN
QFPNSFTSQQSFQLNVQQGSLVQSQELNQQLPKATSSKQISFDKDSQSNSFYGGGVESSL
GDLLEKKDSLSENDISDNYSNNESDFYFDEYNNIPIDGNKINLNVNNQIKSI


>TTHERM_00151600(gene)
ATGTTTAATTGCTGTTTAAAGAATAATTAAAAGCATGACGATGATGATAACGGCAATAAA
AAAAAGGATAAAAGGCTAAAAAGTTAAATAAATATGAAGACAATCAACACTAATGATGAA
TCTATCTCTTAATTATAAGATACAAAACATTATACAAATAATTTAACAGTAACAAAGACA
GATATTTAGAATAATATGAATGCTAATACAGGAATACATAATTAATAAGGGTATATATCT
GAAAAAAGTATACTCTCTCATTTGAATAGTGAGAAGAAAAACCATAGAGACACAGTAGAA
ACACATAATAACAATAACAACAATTATAATAGCTTTTTTACTTCTGGTATGAATACTCCT
AATTATGACTATAATTTCAAAGGTTAAGATATCAATTAATCTGATAAAAAAGGCAATTAG
TAAGTAGCAACTGAGAAGGATAAAACAATTGCTTGTTCTTTAGATGCGAGTAATTTAGAG
CATTTTTAAAAAATTTTTGAAAAGAAGTAGGTAAAAGATTAGTAATTCGTGTAGCAAATA
GACCAGTAAGTAAAGCAAAGGTTTCTTTTGAATAAATTCTTTTTTTTGAGAGACTAAGGA
AATAAGTATGTTACTCTTGCTTATTGCAGTTATTAAGCTTTTTATGTTAATGGCGGGACA
TTTAATTATTCATTAGCGTCAAATAAGAGTACATAAAGTATCTTAAATAACACTAGTTTA
TTATTCAAAGCAGCTCCTAATTAGAATTTAAATGTTTCAAAGCAAATAAATACAAGCTAA
GATAGTATAAATTCTTAAAACAATTCTACTATCTTTACTACTAGTAAAGTACAAAATAAC
AATGTTGATTTTTTAAACTACTAAAGTCTATATGCAAAATTTAAAGTAGATATGGATTAG
ACTGAAAATTTCACACCTTAAAAAATAGCATTTCATATTGCCTAAAAATTTAAAAAATAC
CCTATCTTAATAGACGCCTGCTGTGGTATTGGAGGAAATACTGTGCAAGTAATACTTAAA
TATAACAATCAAAAATTTACAATTTATTTTTCAATAACATTTTAATAATTTTACAATTTT
TTATTTAATAAAAATAGTTTTCCAAAATCAATAAATTTGTTTTTGCTGTTGACTAGAGCT
ATAGAGCTATTAAAACATGCAATGAAAACATAAAAAACCACAAATAAGATGTCTCAAATG
TAGAATTCATTTAAGCAGATTTTTTATCATTAGAGTGTGGCGAGCTAGGCTAATTAAGAG
CTGATATTGTATTCATAAATCCACAGATAGATATGATTTCTGAAACAACAAAACCTGATA
TCTTTAAGCATTCTTCTCCTAATCTCTTAAAAGCAATGAAAAATGCATACAGAATGTCAA
AAAACATAGCTATTCTACTACCCTATTACATAGATATAAACCAAATTCCTATATTATTGG
ATAAGTTTTATAGAATCTACAGAAATTTTCCTTTGTAAATTTAAGAATTTTAATTTTCCA
AAATACTTATTTATTTGAATTAAAAAAATAATATTTTTGTAGAGACATGATTTAACATCA
CTGCCCTCACATAGAGATTATTTATATGAATGGAAAAATTAAGTATTTCTTGATTTTATT
AGGTGACGCATCTAAGGTTATTTAATTTATATTTTTAATTTATATGAATTTGTTAAATTA
ATTTTTAAAAAATAGATATCTTAAGAAGATGAAATTAAATTTCTCCAAGAGTACATATTA
GATAATAGTCCATATAAAGGACCTTATGAAGAAAAAGTGTTAGAGTTGTTAAATACTATA
TTAAGGAAAGTAGGTATGTTTAAATTAATTAGATGTTTAGCTAAATCAATTGATATCAAT
GATCTTTAGAAGTAAAAAAATTTACTAAATTCTTTTAGTGATGAATTAGAAAAAGAGGGC
ATTATCCATCAAAAAGAAATCAAAAATATGTTAAATTTAACAAACAATATTTCAAATGTT
TGTGAAAGTGCTTCTGACTTAGTAGGGTCTCCAAACTAATTTCCAAACAGTTTCACATCT
TAATAAAGCTTTTAGTTAAATGTTTAATAAGGTTCTCTTGTATAATCTTAGGAATTAAAT
TAATAGTTACCAAAAGCTACTAGCTCAAAGTAAATATCATTTGATAAGGATTCATAAAGC
AACTCATTTTATGGAGGAGGAGTAGAAAGCAGTCTCGGAGATTTGTTAGAAAAAAAAGAT
AGCTTAAGTGAAAATGATATTTCTGATAATTACTCCAATAATGAAAGTGATTTCTATTTC
GATGAATATAATAACATTCCAATAGATGGAAATAAAATTAATTTAAATGTAAATAATCAA
ATAAAGTCAATTTGA