Identifiers and Description

Gene Model Identifier

TTHERM_00086760

Standard Name

TGRPE1 (Tetrahymena GrPE 1)

Aliases

PreTt16425 | 6.m00499 | 3836.m02092

Description

co-chaperone GrpE family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00086760

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02467.11.0003279799459891e-139co-chaperone GrpE family prote
in (325 aa)
OxytrichaContig15049.0.g1015.998760051700188e-30GrpE
SGDYOR232W7.999528511121947e-28MGE1 Mitochondrial matrix coch
aperone, acts as a nucleotide
release factor for Ssc1p in pr
otein translocation and foldin
g; also acts as cochaperone fo
r Ssq1p in folding of Fe-S clu
ster proteins; homolog of E. c
oli GrpE
DictyBaseDDB_G02837632.000620012690291e-23grpE on chromosome: 4 position
1238328 to 1239107
WormBaseWBGene000079272.9990241513684e-21GrpE protein homolog, mitochon
drial status:Confirmed Uni
Prot:Q18421 protein_id:CAA87
101.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00086760(coding)
ATGAAATCATTCGCTACTTTAGTCATTAGAGCTGCCAAAACCCAAAACATTGTCAGTACC
GCCTTGCCCAAGAACCTCTTGTAATCAAGAGTCTGTGCCTTCACTTAGATTCCCAAAAAT
AACTTCTGGAAGAATAACGGTTAAGATAATGAAGTTAAAGACGAAGAAGTTGAAGAATTA
GAAAAGTTAACCAAGCAAAGAATGGAAAGTGAAACAGCAAAGAATTAACAATAACAAGAA
TAAGCCGAATTGAAGAAGCAAAAGGAAGCTGAAGAAAAGGCTAAGAAGTAAAAGGAAGAT
GAAGAATGGCTCAAGCAATAAGAACTTAAGGATAAGAAGAGAGAAGAAGAAGTCAGAAAG
ATTCGTGAAAAGGATGCTGAAAAGAAACTCCCCGAAAGTGTTGAATTATTGTTAAAAATG
GAAGGTGAACCTGCTAAGAAGAAAATCTTACACTTATTTGAACAACTCAAAGAAAAGGCT
TAAACTTTAGAATAAGAAAATAAGCTCCTAGCTGAATAGAAAACTGCTTATCAAACATAA
ACTACCACCTGGTAAGAAAAAGCTAAGGAATTACACAATATCACAGAAAATACTTTGAAA
GATATGGAATTGATGAGAATAAGATTAGAAAAGGAAAAAGAATAAACTAAAATCTTTGCT
ATCAGTAAGTTTGCTGGTGAAGTACTTGAAGTCAATGATAACATTGAAAGAGCCCTCAAT
GCTAATAAAGAATTAGCTGGAAAAGAAAATGGTTTGTTTGAAGGTACAATCATGACCCAA
AAAATCTTAGAACAAATCTTATAAAGAAATGGTATTGTTAAACTTAATCCTGAAGGTGAA
AAGTTTGATCCTAACTTCCATGATGCTCTCTGCCAAGTTCCTGATCCCACCAAAGAATCT
GGTAGCGTTGCCTTCGTTGCCCAAACTGGTTACAAAATTTACGATAGAGTCTTACGTCCT
GCTAAAGTTGGTGTTACTTACAAGAACTGA


>TTHERM_00086760(protein)
MKSFATLVIRAAKTQNIVSTALPKNLLQSRVCAFTQIPKNNFWKNNGQDNEVKDEEVEEL
EKLTKQRMESETAKNQQQQEQAELKKQKEAEEKAKKQKEDEEWLKQQELKDKKREEEVRK
IREKDAEKKLPESVELLLKMEGEPAKKKILHLFEQLKEKAQTLEQENKLLAEQKTAYQTQ
TTTWQEKAKELHNITENTLKDMELMRIRLEKEKEQTKIFAISKFAGEVLEVNDNIERALN
ANKELAGKENGLFEGTIMTQKILEQILQRNGIVKLNPEGEKFDPNFHDALCQVPDPTKES
GSVAFVAQTGYKIYDRVLRPAKVGVTYKN


>TTHERM_00086760(gene)
ATGAAATCATTCGCTACTTTAGTCATTAGAGCTGCCAAAACCCAAAACATTGTCAGTACC
GCCTTGCCCAAGAACCTCTTGTAATCAAGAGTCTGTGCCTTCACTTAGATTCCCAAAAAT
AAGTAATTTTTCTCTTCTTTTATTCCATACCATTTAAAAAACTGAAGAAATCTCCCTTCT
AATCAAACTTAGGGTTCATACATTTATTCATTTAAGACTCTTTTTTTAACAGATATATTT
TTAAATAATATTTTACAATAATTATTTTATAATAATAAAGCTTCTGGAAGAATAACGGTT
AAGATAATGAAGTTAAAGACGAAGAAGTTGAAGAATTAGAAAAGTTAACCAAGCAAAGAA
TGGAAAGTGAAACAGCAAAGAATTAACAATAACAAGAATAAGCCGAATTGAAGAAGCAAA
AGGAAGCTGAAGAAAAGGCTAAGAAGTAAAAGGAAGATGAAGAATGGCTCAAGCAATAAG
AACTTAAGGATAAGAAGAGAGAAGAAGAAGTCAGAAAGATTCGTGAAAAGGATGCTGAAA
AGAAACTCCCCGAAAGTGTTGAATTATTGTTAAGTAATCCTTAAATTTTTTACTTTACAA
CTTAGATTCATGATATACAAACAATATGATACATTTATTAGCTCATAATTTTGTTATATT
CAATCAAATTTTAGCGTTTTTATTAATAATTTGTTTTAACTAAAAGAAATGGAAGGTGAA
CCTGCTAAGAAGAAAATCTTACACTTATTTGAACAACTCAAAGAAAAGGCTTAAACTTTA
GAATAAGAAAATAAGCTCCTAGCTGAATAGGTAAAATCCTCAACAATAATTAACTTATGT
TTATTTATAATGCTTTAAAAATATAAATAGAAAACTGCTTATCAAACATAAACTACCACC
TGGTAAGAAAAAGCTAAGGAATTACACAATATCACAGAAAATACTTTGAAAGATATGGAA
TTGATGAGAATAAGATTAGAAAAGGAAAAAGAATAAACTAAAATCTTTGCTATCAGTAAG
TTTGCTGGTGAAGTACTTGAAGTCAATGATAACATTGAAAGAGCCCTCAATGCTAATAAA
GAATTAGCTGGAAAAGAAAATGGTTTGTTTGAAGGTAATTTATTTATTTATTTCTAAATT
ATTACAAAAATAATCCTGCAATTAATCAATCAATTAGACTTTTATTTGTATCTTGCCTAA
TAAATCAAGCTAAATTATCTCCCAAAAGATAATTAAAGGAATATATAAATAAATAAACAA
AAAATTAATTGTCAAAAAATTGATTAATTTCTGTTTTTATTTTTTAATCTTTTTTTTAGC
TTTCTAACTGGATGAAATAATTAATTAATAAATCTTTCTAAAATAATCTTAGGTACAATC
ATGACCCAAAAAATCTTAGAACAAATCTTATAAAGAAATGGTATTGTTAAACTTAATCCT
GAAGGTGAAAAGTTTGATCCTAACTTCCATGATGCTCTCTGCCAAGTTCCTGATCCCACC
AAAGAATCTGGTAGCGTTGCCTTCGTTGCCCAAACTGGTTACAAAATTTACGATAGAGTC
TTACGTCCTGCTAAAGTTGGTGTTACTTACAAGAACTGA