Identifiers and Description

Gene Model Identifier

TTHERM_00499440

Standard Name

TGP3 (Tetrahymena G-DNA binding Protein )

Aliases

PreTt07987 | 63.m00165 | 3716.m00019

Description

G-quartet DNA binding protein; knockout strain shows increased occurrence of extra micronuclei; not essential for growth

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00499440

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09688.15.001630449142324e-150hypothetical protein (363 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:10908364: Lu Q, Henderson E (2000) Two Tetrahymena G-DNA-binding proteins, TGP1 and TGP3, share novel motifs and may play a role in micronuclear division. Nucleic acids research 28(15):2993-3001

Sequences

>TTHERM_00499440(coding)
ATGGCTGAATAAGTTACTAACAACTAAGTCTCTCCTCAAGGAGAACAAAAACCTAAGGTA
TAAAAGAGACCAAGAACTGTTCAATTAGAATCTAAGGATCCTGTTAAGATTGCTGATCTC
TAACCCAGAAACAACAATTCTAACTTTGTTGGAAAGGTTATTGAAGTTTAAGTCTTAGAA
AAAGGCAATAACAAATAAGGCAATCCTAGAAAATTCCTTAAGGGTCTTATTGGTGATGAT
ACTGGTGTTGTCAGATTTGATTTGGCTGTTAAGAACGATGTCGTCTTTAAGGTAGATGAT
GTCGTCAGCTTCGATAAAGCTATGAACAAGGTAAACAAGGATGGTCACCACTACATTGAA
GTCAAGAGATTCGGTAAATACGAAATCACCAACGGCTCTATTGCCGCTGTTAAAACAGAT
AACAACATCTCAACAAAGATAATTCCTCCTCTTCCTGAAGGTGAAAAGAAGTAGAAGATT
ATTAAAAAAAGCAACAATAAGTAGAACAACAATGGTAAAGTTAACAACAACAACAATAAC
GGTGATAACAACACAAACAATAATGGTAACAAAATGAATAACCGCCCTTACAAAAAATAA
AACTACAATTAATAAAGAAAGACTAACAACAACAACAACAACAATAGCAACAACAACACT
AACAACTCTTAGAATTTCAAAAATTACAAATAAAAGCCTAAGAGATTCCACTAAGCTTTA
CTCACTCCTATCAAGAATCTTAAGCCTGGTTAAAACGGTTAAACTGTTAAAGGAAAAGTT
TTCGATGTTTAATCCTACTAAAAGACCATCAAGAATAGAGAAGCTACTTTCTTCAAGGGT
AGAGTTGCTGATGACACTGCAAATATTAATTTTGACTTCATGATGAAAGAAAAGACCATT
TCTGAAGGTGATATGGTTATCTTCACCAACATTATGAATAAGGTTTCAGAAACTGGCCAT
CACTACATCGTAGTCGGCAAGTACGGAAATTACAGTGTCTTGAATGAAAAATAGATCAAC
ATTAATGAATAAGAAAACAAGTCATCTATTGAATACGCCATCAGCTCTTCTAATAATGCC
ACTAAACAATGA


>TTHERM_00499440(protein)
MAEQVTNNQVSPQGEQKPKVQKRPRTVQLESKDPVKIADLQPRNNNSNFVGKVIEVQVLE
KGNNKQGNPRKFLKGLIGDDTGVVRFDLAVKNDVVFKVDDVVSFDKAMNKVNKDGHHYIE
VKRFGKYEITNGSIAAVKTDNNISTKIIPPLPEGEKKQKIIKKSNNKQNNNGKVNNNNNN
GDNNTNNNGNKMNNRPYKKQNYNQQRKTNNNNNNNSNNNTNNSQNFKNYKQKPKRFHQAL
LTPIKNLKPGQNGQTVKGKVFDVQSYQKTIKNREATFFKGRVADDTANINFDFMMKEKTI
SEGDMVIFTNIMNKVSETGHHYIVVGKYGNYSVLNEKQININEQENKSSIEYAISSSNNA
TKQ


>TTHERM_00499440(gene)
AAATAAAGAAAAAATTATCTTTATAATTACAAAAACAACAAAAAATTAATTAATTAATAA
AAAATAATATTCATATTATCTCCTTCAAAACAATAAAATAAAATGGCTGAATAAGTTACT
AACAACTAAGGTAAAAAAACAAACATTAATTGATTCATCTATCATTTGCAATTTAGATAT
TCGATTTTTTAATTTAACTGAAATAATGATTTATTTTATGATAATTAGTCTCTCCTCAAG
GAGAACAAAAACCTAAGGTATAAAAGAGACCAAGAACTGTTCAATTAGAATCTAAGGATC
CTGTTAAGATTGCTGATCTCTAACCCAGAAACAACAATTCTAACTTTGTTGGAAAGGTAC
CTACTTTAATACATAGGATATTAAACTTAAAAAAATAGATGATCATTTAGGATATACTTT
TTTGCCCTTTTCAATTTATATTTAATGTGTTTTAGCTAAATGCCAAATCAAAAAAAGAAA
CAAAAAATAGAATAAAATATTTTTATTGCTTCTAAAAATTAATAAAACTATTTATTCTTA
AAGGTTATTGAAGTTTAAGTCTTAGAAAAAGGCAATAACAAATAAGGCAATCCTAGAAAA
TTCCTTAAGGGTCTTATTGGTGATGATACTGGTGTTGTCAGATTTGATTTGGCTGTTAAG
AACGATGTCGTCTTTAAGGTAGATGATGTCGTCAGCTTCGATAAAGCTATGAACAAGGTA
AACAAGGATGGTCACCACTACATTGAAGTCAAGAGATTCGGTAAATACGAAATCACCAAC
GGCGTAAATTATTGTTTTTTAAAAAATAACAAATCTTCTTCTCCTTTCAAAATTTTGTTT
TAAAAGGGGGAGAACAAATGTATAAAATTAAGTAAATTTTATAATATTAATTTTATACTT
ATTATTTAAAATAGTCTATTGCCGCTGTTAAAACAGATAACAACATCTCAACAAAGATAA
TTCCTCCTCTTCCTGAAGGTAAAAAATATAATTTGATATTTGCAGTAAAGATATTTTGGT
TGGATTGATACACTATGAATTTCATTCAAATTGCAAATATAGCAAATGTTCATTTAATTT
TCTTTGTTTTAATTTTATTACTTATAATTACAAATTAGGTGAAAAGAAGTAGAAGATTAT
TAAAAAAAGCAACAATAAGTAGAACAACAATGGTAAAGTTAACAACAACAACAATAACGG
TGATAACAACACAAACAATAATGGTAACAAAATGAATAACCGCCCTTACAAAAAATAAAA
CTACAATTAATAAAGAAAGACTAACAACAACAACAACAACAATAGCAACAACAACACTAA
CAACTCTTAGAATTTCAAAAATTACAAATAAAAGCCTAAGAGATTCCACTAAGCTTTACT
CACTCCTATCAAGAATCTTAAGCCTGGTTAAAACGGTTAAACTGTTAAAGGAAAAGTAAA
GACTTTGTTTAGAAATGTTCAGATTATATAGATTTATAAAACAATTGAATTGAATCTAAG
AAATTTTAATTTTAATTTATTTACCTTAATAGGTTTTCGATGTTTAATCCTACTAAAAGA
CCATCAAGAATAGAGAAGCTACTTTCTTCAAGGGTAGAGTTGCTGATGACACTGCAAATA
TTAATTTTGACTTCATGATGAAAGAAAAGACCATTTCTGAAGGTGATATGGTTATCTTCA
CCAACATTATGAATAAGGTTTCAGAAACTGGCCATCACTACATCGTAGTCGGCAAGTACG
GAAATTACAGTGTCTTGAATGTAAGCATATTTTTGAATAAATATACATTCTGTCTGACTA
ATGAAAATTATTAAAAAATAGGAAAAATAGATCAACATTAATGAATAAGAAAACAAGTCA
TCTATTGAATACGCCATCAGCTCTTCTAATAATGCCACTAAACAATGA