Identifiers and Description

Gene Model Identifier

TTHERM_00043870

Standard Name

TGP2 (Tetrahymena G-DNA binding Protein )

Aliases

PreTt11064 | 3.m01838 | 3824.m02827

Description

G-quartet DNA binding protein; has dihydrolipoamide dehydrogenase (DLDH) activity; preferentially binds G4-DNA oligonucleotides with adjacent single-stranded domains

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.6%

TetraMine Data

TTHERM_00043870

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_56950
WormBaseWBGene000107949.997093137033517e-262locus:dld-1 Dihydrolipoyl de
hydrogenase, mitochondrial s
tatus:Confirmed UniProt:O179
53 protein_id:CAB05249.2
Tetrahymena borealisEI9_01865.19.997093137033517e-262dihydrolipoamide dehydrogenase
(489 aa)
OxytrichaContig16905.0.g789.997093137033517e-262Pyridine nucleotide-disulphide
oxidoreductase
DictyBaseDDB_G02916484.000089512234839e-180lpd on chromosome: 6 position
70728 to 72507
SGDYFL018C1.0001465636795248e-178LPD1 Dihydrolipoamide dehydrog
enase, the lipoamide dehydroge
nase component (E3) of the pyr
uvate dehydrogenase and 2-oxog
lutarate dehydrogenase multi-e
nzyme complexes

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:9521745: Kee K, Niu L, Henderson E (1998) A Tetrahymena thermophila G4-DNA binding protein with dihydrolipoamide dehydrogenase activity. Biochemistry 37(12):4224-34

Sequences

>TTHERM_00043870(coding)
ATGTTCAAAACTTTTGTTCCTACTAGAAATCTTACCCATAGTCTTAGATAATTGTTCTCC
ACTAGCACTCAATATGATGTCGTCGTTATTGGTGGTGGTCCTGGTGGTTACGTAGCTGCC
ATTAAGGCTGGTTAATTAGGCTTAAAGACCGCTTGTGTTGAAAAGAGAGGTTCTTTGGGT
GGTACCTGCTTAAATGTTGGTTGCATTCCTTCAAAGGCTCTCTTAAACATCTCTTAAAAA
TATTATGATGCTTCCAAGCACTACAAAGAACTTGGTATCGAAGTTGAAGGTGTTAAAATG
AATTGGGCTCAAGCTTAAACAAAGAAGGCTGAAACAGTTACTGGTTTGACCAGAGGTATC
GAAAGTCTCTTCAAGAAGAATAAGGTTGACTACTTTGTTGGTACTGGTAGACTAAATGAC
AAGAACACTATTGGTATTAATCTTAACAATGGTACTTAGTAGGTTATTAACTCCAAGAAC
ATTATTATTGCTACTGGATCTGAACCTACTCCTTTCCCTGGTCTCAACTTCGACGAAAAG
GTTATCATCTCTTCAACTGGTGCTCTCTCTTTACCCTAGATCCCTAAGAAATTAATCGTT
ATTGGTGCTGGTGTTATTGGTTTAGAAATGGGTTCTGTTTACCAAAGATTAGGTACTCAA
GTTACTGTCATTGAATTTGCTGATTAAATTTGCCCTTTCCTTGATACTGATGTTGCTAAG
GCTTTCCAATAGAGCTTAAAGAAATAAGGTTTACAAATTTTGACTGGCCATAAGGTTGTT
TCTGGTTAAAACTTCGGTACTCACGGTAGCGTAGTTGTTGAACCTGTTAAGGGAGGTCCA
TCTTAGACCTTTGAAGCTGATCATATTTTAGTTTCTACAGGTCGTAGACCTTATGTTGAT
GGCTTAAATGCTAAGGAAATCGGTATTGAGTTTGACAACAAAAATAGAATCATCACTAAC
TCCCACTTACAAACCAACATTCCCAATATTTATGCCATAGGTGATGTCATTCCTGGACCT
ATGTTGGCTCACAAGGGTGAAGAAGAAGGTATTGCTGCTGTTGAATATATTGCTGGAAAG
GGTGGTCATGTTAATTACGATGCTATTCCTAGTGTTATCTATACCCATCCTGAAGTTGCT
TGGGTCGGAAAGACTGAATAAGAACTTAAGGCTGCCAATATTAAGTACAACAAGGGTTCT
TTCCCCATGCTTGCTAACTCTAGAGCTAAAGCTAACAACGACTACGATGGTTTAATTAAG
ATCTTAACTGAAAAGGATACTGATAAACTCTTGGGTGTCCATATTATGAATGCATAAGCT
GGTGAATTAATCGGTGAAGCTACTTTAGCCGTCGAATATGGTGCTGCTGCTGAAGATATA
GGTAGAACTTGCCACGCTCATCCTACTATTTCTGAAGCTCTTAAAGAAGCTTGCATGGCT
GCTTATGACAAGCCCATCCACTTCTGA


>TTHERM_00043870(protein)
MFKTFVPTRNLTHSLRQLFSTSTQYDVVVIGGGPGGYVAAIKAGQLGLKTACVEKRGSLG
GTCLNVGCIPSKALLNISQKYYDASKHYKELGIEVEGVKMNWAQAQTKKAETVTGLTRGI
ESLFKKNKVDYFVGTGRLNDKNTIGINLNNGTQQVINSKNIIIATGSEPTPFPGLNFDEK
VIISSTGALSLPQIPKKLIVIGAGVIGLEMGSVYQRLGTQVTVIEFADQICPFLDTDVAK
AFQQSLKKQGLQILTGHKVVSGQNFGTHGSVVVEPVKGGPSQTFEADHILVSTGRRPYVD
GLNAKEIGIEFDNKNRIITNSHLQTNIPNIYAIGDVIPGPMLAHKGEEEGIAAVEYIAGK
GGHVNYDAIPSVIYTHPEVAWVGKTEQELKAANIKYNKGSFPMLANSRAKANNDYDGLIK
ILTEKDTDKLLGVHIMNAQAGELIGEATLAVEYGAAAEDIGRTCHAHPTISEALKEACMA
AYDKPIHF


>TTHERM_00043870(gene)
ATGTTCAAAACTTTTGTTCCTACTAGAAATCTTACCCATAGTCTTAGATAATTGTTCTCC
ACTAGCACTCAATATGATGTCGTCGTTATTGGTGGTGGTCCTGGTGGTAATAATCCTAAT
TATTTAATCAAAATTTTATACAATACAGCTTCTTCTCCTTCTTTTCGCTTTAAAGCAGTA
GCATTTCAGAGGTTATTCATGAAAACTTTGATTATTTAAAAACTGAGAAAAATTCACATA
GTTAAGCAAATATTCTATAAGAGTTGATCAAATATAAAAGATGCGTACTAAATTAAATTA
CAGTTTGTCTTAAAATATGCCTATAGCTAAGGATAATTTCAAATTATGTTCAATAGCTTT
AAGATAGAAGGAGAAGCAAGTGTTTATAGCTGATATAGCTAAAATTAAGAAAAATAGGTT
TATTTAATTATATTATAAATATAAAAGGTTACGTAGCTGCCATTAAGGCTGGTTAATTAG
GCTTAAAGACCGCTTGTGTTGAAAAGAGAGGTTCTTTGGGTGGTACCTGCTTAAATGTTG
GTTGCATTCCTTCAAAGGCTCTCTTAAACATCTCTTAAAAATATTATGATGCTTCCAAGC
ACTACAAAGAACTTGGTATCGAAGTTGAAGGTGTTAAAATGAATTGGGGTAAAATATTAA
ATTCTTTTTATTTTCATCCTCTTAAGAAAAAAAATTTTATCCACCAAAAATGATTTTTTA
CTCAAAATAAATACTTTTTTTTAATTGAATGCTTTTGTTTCAAACATCTAGCTGTTAGCA
AAATAATTTATTATAACTAAAATATATCTAATAAATAGCTCAAGCTTAAACAAAGAAGGC
TGAAACAGTTACTGGTTTGACCAGAGGTATCGAAAGTCTCTTCAAGAAGAATAAGGTTGA
CTACTTTGTTGGTACTGGTAGACTAAATGACAAGAACACTATTGGTATTAATCTTAACAA
TGGTACTTAGTAGGTTATTAACTCCAAGAACATTATTATTGCTACTGGATCTGAACCTAC
TCCTTTCCCTGGTCTCAACTTCGACGAAAAGGTTATCATCTCTTCAACTGGTAAAATAAA
AGATTTGTGGAAATTTATTTATTTACTTAAGCTATAATGAATTTTGTAGATTGATTAGCA
AATAAATAAATAAATAACAAGATTAGATAAGATTTATAAAAAGATATTTAATGAATGAAA
TAAATTGATTAGTAGCACTATTTAATTAATAAATAAAGCAAATTTTTTATCTTTCAATTT
ATCAAGAAATTTCTCAAAATTTTATTTGATGCTTCAATAATTTTTAAGGATTCTGATCTA
ATCTACTTAATTAATTAATTTATTTATTTATTGTATTATTCGAATCTCCTTTTAATCATT
TTATCATTTTACTATTACTTTAATACAGGTGCTCTCTCTTTACCCTAGATCCCTAAGAAA
TTAATCGTTATTGGTGCTGGTGTTATTGGTTTAGAAATGGGTTCTGTTTACCAAAGATTA
GGTACTCAAGTTACTGTCATTGAATTTGCTGATTAAATTTGCCCTTTCCTTGATACTGAT
GTTGCTAAGGCTTTCCAATAGAGCTTAAAGAAATAAGGTTTACAAATTTTGACTGGCCAT
AAGGTTGTTTCTGGTTAAAACTTCGGTACTCACGGTAGCGTAGTTGTTGAACCTGTTAAG
GGAGGTCCATCTTAGACCTTTGAAGCTGATCATATTTTAGTTTCTACAGGTCGTAGACCT
TATGTTGATGGCTTAAATGCTAAGGAAATCGGTATTGAGTTTGACAACAAAAATAGAATC
ATCACTAACTCCCACTTACAAACCAACATTCCCAATATTTATGCCATAGGTGATGTCATT
CCTGGACCTATGTTGGCTCACAAGGGTGAAGAAGAAGGTATTGCTGCTGTTGAATATATT
GCTGGAAAGGGTGGTCATGTTAATTACGATGCTATTCCTAGTGTTATCTATACCCATCCT
GAAGTTGCTTGGGTCGGAAAGACTGAATAAGAACTTAAGGCTGCCAGTAAATATTATTTT
TATTATTAATTTAAAATTAAATTAATCTAAATATTTAAACCAAATTTAATAGATATTAAG
TACAACAAGGGTTCTTTCCCCATGCTTGCTAACTCTAGAGCTAAAGCTAACAACGACTAC
GATGGTTTAATTAAGATCTTAACTGAAAAGGATACTGATAAACTCTTGGGTGTCCATATT
ATGAATGCATAAGCTGGTGAATTAATCGGTGAAGCTACTTTAGCCGTCGAATATGGTGCT
GCTGCTGAAGATATAGGTAGAACTTGCCACGCTCATCCTACTATTTCTGAAGCTCTTAAA
GAAGCTTGCATGGCTGCTTATGACAAGCCCATCCACTTCTGA