Identifiers and Description

Gene Model Identifier

TTHERM_00499420

Standard Name

TGP1 (Tetrahymena G-DNA binding Protein )

Aliases

PreTt07985 | 63.m00163 | 3716.m00017

Description

G-quartet DNA binding protein; shows preference for binding parallel G-DNAs; activity localized predominantly in the nuclear fraction; knockout strain shows increased occurrence of extra micronuclei; not essential for growth

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF04702 ) Vicilin N terminal region
  • ( PF08648 ) Protein of unknown function (DUF1777)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00499420

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09690.11.0000509032773212e-171hypothetical protein (730 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:10908364: Lu Q, Henderson E (2000) Two Tetrahymena G-DNA-binding proteins, TGP1 and TGP3, share novel motifs and may play a role in micronuclear division. Nucleic acids research 28(15):2993-3001
  2. Ref:9512530: Lu Q, Schierer T, Kang SG, Henderson E (1998) Purification, characterization and molecular cloning of TGP1, a novel G-DNA binding protein from Tetrahymena thermophila. Nucleic acids research 26(7):1613-20
  3. Ref:7509637: Schierer T, Henderson E (1994) A protein from Tetrahymena thermophila that specifically binds parallel-stranded G4-DNA. Biochemistry 33(8):2240-6

Sequences

>TTHERM_00499420(coding)
ATGACTGATCAAGGTGTCGCTAAAGAACAATACATTACCGTCGGTAGTTTGAAGGAAATT
GCAGATCCCGTCAAGAAATTCCTTAGAAAGGGAAACAGAAAGGGTAGAAATTAGAAGGAA
TTAAAGTTCAGAGCTAAGGTTGTTAACCAATAACTTGCTGACGAAACTGGCTCTATCAAC
TTCACTACTGAAGGTGTTGCCGTAAATAACAACCAAACTTATGAATTCACTGGTTCCTTG
AAGGTTGTCGACTATAAGCTCAACTTAGCTGTTACCTCTGCTACTCCTGCTAAAGATTAA
ATTGCTAATCTTGGTTCTGAATAACTCAGCAAAGCTGATATTGATCAACACTCAGGAAAG
CATATCGTTTTGATCAAGGATCTCATTAATCTTAGAATCGGTCAATCTTTCTTCGCTAGA
CCTAGAGATATTGTTCACAATAACGAATAAAGAAGAATGACAGCTACCTTAGCCGATAAC
ACTGCTGCTATCCAAGCTGAAATTAGTGTTAACAAGAAATCAATCACTTAAGAAGTACTT
GAATCCTTAAACTCTGATAAGGTCTACCTTTTCAGTGATGTTGTTCTCAACTTCAATGAA
AGTAACAAGTTAGTTGCCAGATTCAACTACAGATCAAACATTGTTGAAGCTAATGACCGT
TAGATCTAACAATTATCAAATAACAACTTGAGCGCCAAAGAATACTCAGATGAAACTGAA
AAGAAGGCTCTTACTGATGTCCTCTAAATCCATGAAAAGAAGGAAAGAGTTCACAAATAG
TAAAATAAGAATAAAAATACAAGAAATGCTCACAAGAATCACAACAGATAAAGACCAAAT
TTATAAGAAACTGAACCCGTAAAAATTAGCGGTCTCTAATAATGGAACAATAACTAGACA
GTTATTGGCAAGATTGTCTCTCTCCGCACTGAAGATAAGTCTTTACCAGCTAAGCAAGAC
GGTACCTCAACTACCATGGTCTACCTTAAGGGAACTATTGGTGACGAAACAGGTGTAATT
GATTTCGATATGGCTGAAAAAAGAGATTGCCCTCGTTTCAAAGAAAATGATGTCGTTAAA
TTCACCTCTGTAATGAACAAAGGTAGATAAAGCGCTGAAGGAAAAGTCGGTGGTCACTAC
ATCGAAGTTAAGAAATTCGGTCAATATATTATCCTTTCAGATCATAATATTAACAATGTA
AATTTAAACAATAACTTGTCTAATTTAGAACTCACCGCTCGTCCCAAGAATCCCAACCCA
AGATTCATCAAGGGAGAATTTGTTGGTGTAAAGGAAGAAGAAAAAGATGGAAACATCTAA
TATACTTACACTGTCAGAAGTAAAGAAGGTGAAGAACAATCTATCACTATTAGAAACAAA
ATTACTACACTTAAAGTTGGTGAAATTCACAAAATCGATAGAGAAAGAAAAAGATCAAGT
AGCAGACCTAATCATCAAGGTGGTTAAAGGGGAAATAGATCTCATTCTTAAAATAACAGA
AACCAAAGAAATAGAGATAAGCACCACAATAGCTAAAACAATTAACCCAATAAATACAAC
AAAAACACTTCCGTCTAAAACAATAACAACAACAAAAACTAATAAAGATCTTAATCACAA
AACCAAAGACCTCCTAGAAACTATGATAACAGACAAGGAGGTGAAAATAGAAATAATAGA
TAAAGAAATGAAAATAATAGAAATAATTTCAATGGCAATGGTCATAGAGTCAATAACCAA
AACAATCAAAGAAATAGAAATAGCTCATATCCTAGAAATAATAACTATGATCATCATCAT
AATTAATAAACCGATATTTCTGGCTTAGAACCTGGTAAGAGAGGTCAAAATGTAACTGGT
TAGGTGATTGAAGTTTCTGAATTCTCCAAGTAGATCAATGATAAAACTTTACACTTTGTC
AAGGGTAGAATTGCTGATGAAAATGCTAATATTAGATTTGATATCAAGAAACCTTAAAAC
TTAGAAATTAAGGTTGGTGAAGTCTATAATTTCAAGGACGTTAACAACAAAGTTGATGAT
AATGGTTACCACTATATTGACCTCAATAGATTTGGCAGAGTTTTCCCTTCTCATAAAAAA
TTCTAAAGCATTAATGATAAAAGAAATTGTGATGCTGATCGTTCATCAATTGAATACGTC
AAAAAAACTGTCCCTAACTGA


>TTHERM_00499420(protein)
MTDQGVAKEQYITVGSLKEIADPVKKFLRKGNRKGRNQKELKFRAKVVNQQLADETGSIN
FTTEGVAVNNNQTYEFTGSLKVVDYKLNLAVTSATPAKDQIANLGSEQLSKADIDQHSGK
HIVLIKDLINLRIGQSFFARPRDIVHNNEQRRMTATLADNTAAIQAEISVNKKSITQEVL
ESLNSDKVYLFSDVVLNFNESNKLVARFNYRSNIVEANDRQIQQLSNNNLSAKEYSDETE
KKALTDVLQIHEKKERVHKQQNKNKNTRNAHKNHNRQRPNLQETEPVKISGLQQWNNNQT
VIGKIVSLRTEDKSLPAKQDGTSTTMVYLKGTIGDETGVIDFDMAEKRDCPRFKENDVVK
FTSVMNKGRQSAEGKVGGHYIEVKKFGQYIILSDHNINNVNLNNNLSNLELTARPKNPNP
RFIKGEFVGVKEEEKDGNIQYTYTVRSKEGEEQSITIRNKITTLKVGEIHKIDRERKRSS
SRPNHQGGQRGNRSHSQNNRNQRNRDKHHNSQNNQPNKYNKNTSVQNNNNNKNQQRSQSQ
NQRPPRNYDNRQGGENRNNRQRNENNRNNFNGNGHRVNNQNNQRNRNSSYPRNNNYDHHH
NQQTDISGLEPGKRGQNVTGQVIEVSEFSKQINDKTLHFVKGRIADENANIRFDIKKPQN
LEIKVGEVYNFKDVNNKVDDNGYHYIDLNRFGRVFPSHKKFQSINDKRNCDADRSSIEYV
KKTVPN


>TTHERM_00499420(gene)
AAAAAGAAAAAATTAAATTATTTAGAAAAAGATATTTTTCACATTCAAAATAAAATAAAA
AAAACTCCACTTAAAAAAAAAACAACAACAACAAAAATTAAAAAAATGACTGATCAAGGT
GTCGCTAAAGAACAATGTATAATTTTAAATGTCTATTGATGATTAAATTCATTATAAATT
TAATCTTCTTACCATTCAAAATTTATTAATTTGTCTTTGTTTTTACAAAAAGACATTACC
GTCGGTAGTTTGAAGGAAATTGCAGATCCCGTCAAGAAATTCCTTAGAAAGGGAAACAGA
AAGGGTAGAAATTAGAAGGAATTAAAGTTCAGAGCTAAGGTATGAAATTAAATTAACATT
CTCCCTTAACTTGAAAATACCATTTTTACAGAGTGATTAAAAATCTGCCTATTTATAAAT
CAATAAAGTTGATTTTAAAGCTGTATTGGTAGGTCTAGCATAGGCTGGACATTATCAAAT
ATTTATTTTTTAAGCTTTTACATTCCAAGTTAATTATTCTAAATTATTTAATATATTCAA
TAGGTTGTTAACCAATAACTTGCTGACGAAACTGGCTCTATCAACTTCACTACTGAAGGT
AATTTCAAAAATGAATATTGTATATAAAATTAATTTTATATATTTTTATAATTTATAGGT
GTTGCCGTAAATAACAACCAAACTTATGAATTCACTGGTTCCTTGAAGGTTGTCGACTAT
AAGCTCAACTTAGCTGTTACCTCTGCTACTCCTGCTAAAGATTAAGTACGATTGTTTGAT
AAAATAAGCTAATTTTTGAAAATTAAATAAAATTTATTAGATTGCTAATCTTGGTTCTGA
ATAACTCAGCAAAGCTGATATTGATCAACACTCAGGAAAGCATATCGTTTTGATCAAGGA
TCTCATTAATCTTAGAATCGGTCAATCTTTCTTCGCTAGAGTAATTTTTAAAATAGTTTG
TAGATTTTATATTAATATTTATCATTTTTTATAATTTTAATCTTAAAGCCTAGAGATATT
GTTCACAATAACGAATAAAGAAGAATGACAGCTACCTTAGCCGATAACACTGCTGCTATC
CAAGCTGAAATTAGTGTTAACAAGAAATGTAAACAATAAAATTTATTTTAACTAGATATA
TAGAAAGGCAAAATATTATTGCATCATGAAAAAAGTTAGCATTTGTAGAGTAAAAGGATA
TAGATAAATAAACAAATCTATACATATATAGTTAGCCATAAGTATTAGAAGTTTTAAATT
AATTTTTCAATAAATATATCAAATAGATACTTTTGTTTAGGAAAAATAAAGTATATTGTG
GCTATCATTATAAGAATTAAATAAATCAAATTAATTATTTGTTTAGACATTTTAAATCTA
AATGAATAAATTTATTACAAGTTAATAAATACCCTTTTTTAATTAAAGCATCTTATAAAA
GTTAAAGAATAAATAAACATTTGCAAATTTATTTATTTATTTACTTTAAACTAAATTATT
AAATCACAAAGAGATTATTTAAATGATAATTTATTCTTATTTTTAAAATCAAATCACATC
TCCAATTTTGCGCCTTAATATCTTTCAACACTAATTCAAATTTGGGTTAAATTAATTTTA
ATTAATATCTATTTATTGATAAATAAATAGCAATCACTTAAGAAGTACTTGAATCCTTAA
ACTCTGATAAGGTCTACCTTTTCAGTGATGTTGTTCTCAACTTCAATGAAAGTAACAAGT
TAGTTGCCAGATTCAACTACAGATCAAACATTGTTGAAGCTAATGACCGTTAGATCTAAC
AATTATCAAATAACAACTTGAGCGCCAAAGAATACTCAGATGAAACTGAAAAGAAGGCTC
TTACTGATGTCCTCTAAATCCATGAAAAGAAGGAAAGAGTTCACAAATAGTAAAATAAGA
ATAAAAATACAAGAAATGCTCACAAGAATCACAACAGATAAAGACCAAATTTATAAGAAA
CTGAACCCGTAAAAATTAGCGGTCTCTAATAATGGAACAATAACTAGACAGTTATTGGCA
AGGTAATAGTTTAACTATTCTAAATATTTTTTTTATTTTAAAATATATTAAAAATGTAGA
TTGTCTCTCTCCGCACTGAAGATAAGTCTTTACCAGCTAAGCAAGACGGTACCTCAACTA
CCATGGTCTACCTTAAGGGAACTATTGGTGACGAAACAGGTGTAATTGATTTCGATATGG
CTGAAAAAAGAGATTGCCCTCGTTTCAAAGAAAATGATGTCGTTAAATTCACCTCTGTAA
TGAACAAAGGTAGATAAAGCGCTGAAGGAAAAGTCGGTGGTCACTACATCGAAGTTAAGA
AATTCGGTCAATATATTATCCTTTCAGATGTAATCACTTTAAATAATTTTCATTTAGGAA
TATCACTAAATAATTTATATTATTAATAAAGCATAATATTAACAATGTAAATTTAAACAA
TAACTTGTCTAATTTAGAACTCACCGCTCGTCCCAAGAATCCCAACCCAAGATTCATCAA
GGGAGAAGTAAAAGATTATTTTTCTTAAAATTTTTAATATTCTTTATAATAAAGATGAAT
TAAAATTAAATATCAATTTTATTAGTTTGTTGGTGTAAAGGAAGAAGAAAAAGATGGAAA
CATCTAATATACTTACACTGTCAGAAGTAAAGAAGGTGAAGAACAATCTATCACTATTAG
AAACAAAATTACTACACTTAAAGTTGGTGAAATTCACAAAATCGATAGAGAAAGAAAAAG
AGTAAATAATTTATTATAACAAATTAAAACATTTTTGTTAATTTTTATTCTATTTTAGTC
AAGTAGCAGACCTAATCATCAAGGTGGTTAAAGGGGAAATAGATCTCATTCTTAAAATAA
CAGTAATTCCAAACTAATTATTAATAAAAGTATTTATCTTAGCATTTTTTACTTAAATAA
TAAAAGGAAACCAAAGAAATAGAGATAAGCACCACAATAGCTAAAACAATTAACCCAATA
AATACAACAAAAACACTTCCGTCTAAAACAATAACAACAACAAAAACTAATAAAGATCTT
AATCACAAAACCAAAGACCTCCTAGAAACTATGATAACAGACAAGGAGGTGAAAATAGAA
ATAATAGATAAAGAAATGAAAATAATAGAAATAATTTCAATGGCAATGGTCATAGAGTCA
ATAACCAAAACAATCAAAGAAATAGAAATAGCTCATATCCTAGAAATAATAACTATGATC
ATCATCATAATTAATAAACCGATATTTCTGGCTTAGAACCTGGTAAGAGAGGTCAAAATG
TAACTGGTTAGGTAAAGATAAATTTAAAATTAAATAAAAAAATGATATATCTAAATAACT
ATAATTAGGTGATTGAAGTTTCTGAATTCTCCAAGTAGATCAATGATAAAACTTTACACT
TTGTCAAGGGTAGAATTGCTGATGAAAATGCTAATATTAGATTTGATATCAAGAAACCTT
AAAACTTAGAAATTAAGGTTGGTGAAGTCTATAATTTCAAGGACGTTAACAACAAAGTTG
ATGATAATGGTTACCACTATATTGACCTCAATAGATTTGGCAGAGTTTTCCCTTCTCATA
AAGTAAATAATTATTTTTAAAAATATTTTATTCATATAATTATTTGTTAAAAAATTAGAA
ATTCTAAAGCATTAATGATAAAAGAAATTGTGATGCTGATCGTTCATCAATTGAATACGT
CAAAAAAACTGTCCCTAACTGA