Identifiers and Description

Gene Model Identifier

TTHERM_00313400

Standard Name

TGL9 (TriGlyceride Lipase)

Aliases

PreTt03527 | 30.m00336 | 3810.m01948

Description

ab-hydrolase associated lipase region family protein; Steryl ester hydrolase, similar to yeast TGL1, YEH1 and YEH2 steryl ester hydrolases

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 21.3%

TetraMine Data

TTHERM_00313400

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03353.19.997093137033517e-262ab-hydrolase associated lipase
region family protein (425 aa
)
OxytrichaContig12456.0.g211.999385218781115e-51Partial alpha/beta-hydrolase l
ipase region
DictyBaseDDB_G02687405.000307300873256e-47lip2 on chromosome: 1 position
2028102 to 2029414
WormBaseWBGene000219632.998863950472602e-38locus:lipl-6 status:Partiall
y_confirmed UniProt:E2S7J2
protein_id:CCD72909.1
SGDYKL140W5.0013199114200274e-20TGL1 Steryl ester hydrolase, o
ne of three gene products (Yeh
1p, Yeh2p, Tgl1p) responsible
for steryl ester hydrolase act
ivity and involved in sterol h
omeostasis; localized to lipid
particle membranes
Stentor CoeruleusSteCoe_301082.1151310375910805e-19

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00313400(coding)
ATGTCCAACAAAACTGCTAAATTGCAAATTATTGGCTTATTTATTGCCTATATAATTCTT
ATAGTCATCTACAAGGATGGTGATATGAGTGATTTTGAAGATTTTCAAACTCGTTCTATT
AAATTAGGATATAATTTTGAAGAACATTTTGTTGAAACCGAAGATGGTTTCATCATAAGC
ATTCACAGAGTTAGAGCTAAAAATAATTCTGAGTTAGAAACCTCTCAGAACTTTAATAAT
AATGAAACAAGCATTAATATGGAGACTTTATAATAATTATAGAAGAAAAACCCAATTTTA
ATGGGACATGGACTAGGTGGTAGCTCAGATACATTTAACAGAAATGTAGAAGAAAAAAGT
TTAGCTTACTTCTTAGCTAGAAGTGGCTATGATATTTTTATCATGAATTCCAGAGGAAAT
AAATATTCATATCAACACAAGATTTATTCTATAGAATAAAGTGAATATTGGGACTTCAGC
TTTTAAGATATGGCTAAATACGATGTTCCTGCTGTTGCCAATTATATTTTAAATAAAATA
TATAATTAATAAGCATAAAATTAATAATAAACTATAGAATAAAATGAATAAATTAAATTA
AACTACATAGGACATTCATAAGGTTGTACTATTATCTTAGCTGCTTTATCTGATAAGTCT
GTACCTAGTAGTTACTTCGAAAATGTTGTATTAATGACACCTGCTGCTCTTATCTTACAT
GGTACATCTCCTGTCTCTGATTTTATCTAAAAAGTAGACGTTCTAAGCTTTTTCTAGTAA
GCTGGTTTACACAAATTCCTATAGATGAATGCATTTAATTATTATTTATGCAGAGCTATC
CCCTACATCTGTGAATTCTCCGTAGGAATCACAACTGATAACTTCGAATCTCCAATTAAT
CATGATTTATTCTATAAATTAATGTACCACTATCCTGCAGGAACAAGCACAAAAGCTTAT
ATTCACTTTAATTAATTAATGAAATCTAAAAAATTCTAAAAATTTGATTATGGTGCTGAA
AAGAACTTTGCTATGTACAACTCTACATAAGTTCCAGAATACGCTTTAAGCAATATTAAT
AATAAAATCCACATTCTTGCAGGAACTCAAGATATTATTACACCCTTAGAAGATATCTAC
TATTTAAAAGAATAATTAGTAAATGCATAAAATGTCACTATAACACTTTTTAATGAAGGC
CACTGCTCATTTATTATTGGAAAAGAAAATGAATTCTTAAATTTCATCCCTTAAATATTA
GTTTGA


>TTHERM_00313400(protein)
MSNKTAKLQIIGLFIAYIILIVIYKDGDMSDFEDFQTRSIKLGYNFEEHFVETEDGFIIS
IHRVRAKNNSELETSQNFNNNETSINMETLQQLQKKNPILMGHGLGGSSDTFNRNVEEKS
LAYFLARSGYDIFIMNSRGNKYSYQHKIYSIEQSEYWDFSFQDMAKYDVPAVANYILNKI
YNQQAQNQQQTIEQNEQIKLNYIGHSQGCTIILAALSDKSVPSSYFENVVLMTPAALILH
GTSPVSDFIQKVDVLSFFQQAGLHKFLQMNAFNYYLCRAIPYICEFSVGITTDNFESPIN
HDLFYKLMYHYPAGTSTKAYIHFNQLMKSKKFQKFDYGAEKNFAMYNSTQVPEYALSNIN
NKIHILAGTQDIITPLEDIYYLKEQLVNAQNVTITLFNEGHCSFIIGKENEFLNFIPQIL
V


>TTHERM_00313400(gene)
ATGTCCAACAAAACTGCTAAATTGCAAATTATTGGCTTATTTATTGCCTATATAATTCTT
ATAGTCATCTACAAGGATGGTGATATGAGTGATTTTGAAGATTTTCAAACTCGTTCTATT
AAATTAGGATATAATTTTGAAGAACATTTTGTTGAAACCGAAGATGGTTTCATCATAAGC
ATTCACAGAGTTAGAGCTAAAAATAATTCTGAGTTAGAAACCTCTCAGAACTTTAATAAT
AATGAAACAAGCATTAATATGGAGACTTTATAATAATTATAGAAGAAAAACCCAATTTTA
ATGGGACATGGACTAGGTGGTAGCTCAGATACATTTAACAGAAATGTAGAAGAAAAAAGT
TTAGCTTACTTCTTAGCTAGAAGTGGCTATGATATTTTTATCATGAATTCCAGAGGAAAT
AAATATTCATATCAACACAAGATTTATTCTATAGAATAAAGTGAATATTGGGACTTCAGC
TTTTAAGATATGGCTAAATACGATGTTCCTGCTGTTGCCAATTATATTTTAAATAAAATA
TATAATTAATAAGCATAAAATTAATAATAAACTATAGAATAAAATGAATAAATTAAATTA
AACTACATAGGACATTCATAAGGTTGTACTATTATCTTAGCTGCTTTATCTGATAAGTCT
GTACCTAGTAGTTACTTCGAAAATGTTGTATTAATGACACCTGCTGCTCTTATCTTACAT
GGTACATCTCCTGTCTCTGATTTTATCTAAAAAGTAGACGTTCTAAGCTTTTTCTAGTAA
GCTGGTTTACACAAATTCCTATAGATGAATGCATTTAATTATTATTTATGCAGAGCTATC
CCCTACATCTGTGAATTCTCCGTAGGAATCACAACTGATAACTTCGAATCTCCAATTAAT
CATGATTTATTCTATAAATTAATGTACCACTATCCTGCAGGAACAAGCACAAAAGCTTAT
ATTCACTTTAATTAATTAATGAAATCTAAAAAATTCTAAAAATTTGATTATGGTGCTGAA
AAGAACTTTGCTATGTACAACTCTACATAAGTTCCAGAATACGCTTTAAGCAATATTAAT
AATAAAATCCACATTCTTGCAGGAACTCAAGATATTATTACACCCTTAGAAGATATCTAC
TATTTAAAAGAATAATTAGTAAATGCATAAAATGTCACTATAACACTTTTTAATGAAGGC
CACTGCTCATTTATTATTGGAAAAGAAAATGAATTCTTAAATTTCATCCCTTAAATATTA
GTTTGA