Identifiers and Description

Gene Model Identifier

TTHERM_00158170

Standard Name

TGL8 (TriGlyceride Lipase)

Aliases

PreTt28407 | 13.m00366 | 3829.m01220

Description

TGL8 Ab-hydrolase associated lipase region protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08108 ) Halocidin family
  • ( PF00561 ) hydrolase, alpha/beta fold family
  • ( PF04083 ) ab-hydrolase associated lipase region
  • ( PF05704 ) Capsular polysaccharide synthesis protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.7%

TetraMine Data

TTHERM_00158170

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05274.19.997093137033517e-262ab-hydrolase associated lipase
region family protein (422 aa
)
DictyBaseDDB_G02687401.9991939848149086e-44lip2 on chromosome: 1 position
2028102 to 2029414
OxytrichaContig10401.0.g791.9991939848149086e-44Partial alpha/beta-hydrolase l
ipase region
WormBaseWBGene000100626.000354955737408e-39locus:lipl-1 Lipase status
:Confirmed UniProt:Q93789
protein_id:CAB01973.1
Stentor CoeruleusSteCoe_295201.2995814250075031e-24
SGDYKL140W7.001446474249442e-19TGL1 Steryl ester hydrolase, o
ne of three gene products (Yeh
1p, Yeh2p, Tgl1p) responsible
for steryl ester hydrolase act
ivity and involved in sterol h
omeostasis; localized to lipid
particle membranes

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00158170(coding)
ATGGGCGTATAATTTGAATAACCCTCTAATTTACCAACAATGATCAAGAATTTTTGCTTA
TAGTTTACTAAAATATATTGTGCTTTTTTAGTAGTCATCATCATTTCTATAGGATAAATG
GCTTTGATGGAAATGCAGATAAAAGACCCTCTATAACGTCCTCATCAAATAAAATACACT
GATTATACAGATATTTTAAACTATCCTACTTAAGAGTACAATATAACTACTGAAGATGGT
TATATCATTAATATTATAAGAATACAAGCTAAAAATACTACCATTTAAGAGCATGGAAAG
CCTCCTGTTTTGATGTATTTCGGTCTTAATTGTGCTATTGAGGTTTTCAGTATGAATAAT
GAAGAATAATCTCCTACTTTTTTTGTTGCTAATCAAGGCTATGATGTTTGGATGATCGCT
AATAGAGGCACATTATACTCAAGTGGACACGTTAACTTAACATAAAATGACCCAGAATAC
TGGTAATTTTCATGGTAGGAAATGGCAGAATATGATTTCAGGAGTGCATTCGATTTTATT
TATGAAAAAGTAGGCAGAAAAAAAATATCTACCATAGGATTTTCTTAAGGCACAACTATA
TTATTAGCTGCTTTAGCTGATTATCCAAATTATTAATAGAAAATAACACAAATGATTTTA
ATGGGCCCAACTGCTAACATAATAAATTAGAATTCACCTGCTTTCACCTTAGGTATAAAC
ATTGGAGGTGCTCCTTTGCTAAAGAAATTGGGCATAAACAAGCTTGTAGATGAATATAAA
TTGCTTTATTATGGCACAAAATATCTTTCTACTTTTGCTCACTTTGTTTTGAGTTAAATA
ACTGATTCTGACGTTACAGTTTTGAACTAAGAAAGATTCTAGTACTTTATGGCAACATAT
CCAGGAGGCACTTCAGTGTAAGTTTATGACCATTGGTAATAATTAGCCAGTGAAACAGAT
TAATTTAGAAAATATGACTATAGAAACGTCACTAAAAATATTATAAAATACGGCAGTGAG
GTCCCTCCTACTTACAATTTATAAAATATTAAAGTGCCTACACATTTGTTTGTTGGCAGA
TATGATAGGTTGGGCAGTCCTGAAGATGCACAAATACTTTACGAAAGTCTTAAACTCTCC
TCTGTAAATGCAACTATGTAATTATATGATGGAGGACATCTCTACTTCGCTATAGGACGC
GAAACTCCTTTTCTTTAAAAGCTTTAATAAATGTTGATTGACTAGCATAAAGCTGATGAT
TGA


>TTHERM_00158170(protein)
MGVQFEQPSNLPTMIKNFCLQFTKIYCAFLVVIIISIGQMALMEMQIKDPLQRPHQIKYT
DYTDILNYPTQEYNITTEDGYIINIIRIQAKNTTIQEHGKPPVLMYFGLNCAIEVFSMNN
EEQSPTFFVANQGYDVWMIANRGTLYSSGHVNLTQNDPEYWQFSWQEMAEYDFRSAFDFI
YEKVGRKKISTIGFSQGTTILLAALADYPNYQQKITQMILMGPTANIINQNSPAFTLGIN
IGGAPLLKKLGINKLVDEYKLLYYGTKYLSTFAHFVLSQITDSDVTVLNQERFQYFMATY
PGGTSVQVYDHWQQLASETDQFRKYDYRNVTKNIIKYGSEVPPTYNLQNIKVPTHLFVGR
YDRLGSPEDAQILYESLKLSSVNATMQLYDGGHLYFAIGRETPFLQKLQQMLIDQHKADD


>TTHERM_00158170(gene)
ATGGGCGTATAATTTGAATAACCCTCTAATTTACCAACAATGATCAAGAATTTTTGCTTA
TAGTTTACTAAAATATATTGTGCTTTTTTAGTAGTCATCATCATTTCTATAGGATAAATG
GCTTTGATGGAAATGCAGATAAAAGACCCTCTATAACGTCCTCATCAAATAAAATACACT
GATTATACAGATATTTTAAACTATCCTACTTAAGAGTACAATATAACTACTGAAGATGGT
TATATCATTAATATTATAAGAATACAAGCTAAAAATACTACCATTTAAGAGCATGGAAAG
CCTCCTGTTTTGATGTATTTCGGTCTTAATTGTGCTATTGAGGTTTTCAGTATGAATAAT
GAAGAATAATCTCCTACTTTTTTTGTTGCTAATCAAGGCTATGATGTTTGGATGATCGCT
AATAGAGGCACATTATACTCAAGTGGACACGTTAACTTAACATAAAATGACCCAGAATAC
TGGTAATTTTCATGGTAGGAAATGGCAGAATATGATTTCAGGAGTGCATTCGATTTTATT
TATGAAAAAGTAGGCAGAAAAAAAATATCTACCATAGGATTTTCTTAAGGCACAACTATA
TTATTAGCTGCTTTAGCTGATTATCCAAATTATTAATAGAAAATAACACAAATGATTTTA
ATGGGCCCAACTGCTAACATAATAAATTAGAATTCACCTGCTTTCACCTTAGGTATAAAC
ATTGGAGGTGCTCCTTTGCTAAAGAAATTGGGCATAAACAAGCTTGTAGATGAATATAAA
TTGCTTTATTATGGCACAAAATATCTTTCTACTTTTGCTCACTTTGTTTTGAGTTAAATA
ACTGATTCTGACGTTACAGTTTTGAACTAAGAAAGATTCTAGTACTTTATGGCAACATAT
CCAGGAGGCACTTCAGTGTAAGTTTATGACCATTGGTAATAATTAGCCAGTGAAACAGAT
TAATTTAGAAAATATGACTATAGAAACGTCACTAAAAATATTATAAAATACGGCAGTGAG
GTCCCTCCTACTTACAATTTATAAAATATTAAAGTGCCTACACATTTGTTTGTTGGCAGA
TATGATAGGTTGGGCAGTCCTGAAGATGCACAAATACTTTACGAAAGTCTTAAACTCTCC
TCTGTAAATGCAACTATGTAATTATATGATGGAGGACATCTCTACTTCGCTATAGGACGC
GAAACTCCTTTTCTTTAAAAGCTTTAATAAATGTTGATTGACTAGCATAAAGCTGATGAT
TGA