Identifiers and Description

Gene Model Identifier

TTHERM_00378810

Standard Name

TGL6 (TriGlyceride Lipase)

Aliases

PreTt10335 | 40.m00220

Description

TGL6 ab-hydrolase associated lipase region protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00561 ) hydrolase, alpha/beta fold family
  • ( PF04083 ) ab-hydrolase associated lipase region

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 39.3%

TetraMine Data

TTHERM_00378810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00093.19.997093137033517e-262ab-hydrolase associated lipase
region family protein (422 aa
)
OxytrichaContig10401.0.g797.000994150992129e-77Partial alpha/beta-hydrolase l
ipase region
WormBaseWBGene000219637.001368147796582e-60locus:lipl-6 status:Partiall
y_confirmed UniProt:E2S7J2
protein_id:CCD72909.1
DictyBaseDDB_G02760838.998929084478212e-60lip4 on chromosome: 2 position
6415536 to 6416900
Stentor CoeruleusSteCoe_301072.6786369618080778e-33
SGDYKL140W1.0002124404074584e-26TGL1 Steryl ester hydrolase, o
ne of three gene products (Yeh
1p, Yeh2p, Tgl1p) responsible
for steryl ester hydrolase act
ivity and involved in sterol h
omeostasis; localized to lipid
particle membranes

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00378810(coding)
ATGAATTAAGTCACTAAAATTTTCTTAATTGTCTTGGCCTTAACTGGAGGAGCTTTGTTG
GTAAACCTCCTCTGGCCTAAGTACCATAAAGAAGCTTGGCTCGAAACCATGGACTACTAC
AAATATTTTGGATATCCTGCAGAAAACCATTATGTCACTACTTCTGATGGATACATTCTT
TAGATATTCAGAATTCAAGCCAAAAATACATAAATCAAGCAAACTGGCTTACCTGTTGTC
TTCTTATAGCATGGTCTTCTTGATAACTCAGATACTTTCTTCATCAACAGCGAAGATAAG
GCACCTGCTTTCATTTTAGCTAATGCTGGTTATGATGTTTGGATGGGTAACAATAGAGGA
AACCGCCACTCAAGAAATCACACTACTTACAACCCTGATACTGATAAGGAGTAGTTCTGG
GCCTTTACTTACGATGATTTCGCTGAAAAGGATTTAGCTAGCATGCTCACTTATGTAACT
GATGCCACTGGATAGGCTTAGCTTGATTATATTGGTCACTCATAGGGTACTACCTAGATG
TTTGCTGCTTTAAGTGAAGGAATTCCAGAAGTAGTTTCTAGAGTTAGAAAATTCCTTGCT
TTTGGTCCAGTCACATACATAAACCACGGAAAACCTAACCTACCCGAATCATTTTTACGT
TTAGCCAACGTTACTGAGTTAGTTGAATTATACAATTTTGCAAACTTGATCGACCCTGCC
CACAGAGCTGAGAAGATGTATGAATGGCTTAAGAACCACACAATATACGAAATTATGCCT
TTCAATAAGGTCATTAGAGATTTAGGTATTGAATTTTGTGGTAAATTCCCTTTACCTTGT
GGTAAGCTTGTTGGTGCAATTACAAGCAATGATTATAGAATTGACAACTATGATAGATAT
GATGTTTTAGCAGGTCATGATCCTGCTGGTACTTCTTTCAGAAATGTAGCTCACTGGATG
CAATTAAAATTATCAGGAAAATTCTAAAAGTTTGATTTTGGTCATAAGGAAAACAAAAAG
AGATATGGAGTTGATTATCCTCCTATTTATGATTTAAGCAAAATTTAAAAAGAAGTCTAT
ATGTTTGTTGGAAATAATGATATTTTAGCTGATGTAACTGATGCTAACTAAACTCGTAGT
GAATTAACAGGAGCCAAGAGAGTTTGGTGGAAGTAATACACTGCTGGTCACTGCTCTTTT
ATGTGGTCTAAGGATATGTCCCATATGGAGGATGTATTATAAATTCTTAGTAACCAGATC
TGA


>TTHERM_00378810(protein)
MNQVTKIFLIVLALTGGALLVNLLWPKYHKEAWLETMDYYKYFGYPAENHYVTTSDGYIL
QIFRIQAKNTQIKQTGLPVVFLQHGLLDNSDTFFINSEDKAPAFILANAGYDVWMGNNRG
NRHSRNHTTYNPDTDKEQFWAFTYDDFAEKDLASMLTYVTDATGQAQLDYIGHSQGTTQM
FAALSEGIPEVVSRVRKFLAFGPVTYINHGKPNLPESFLRLANVTELVELYNFANLIDPA
HRAEKMYEWLKNHTIYEIMPFNKVIRDLGIEFCGKFPLPCGKLVGAITSNDYRIDNYDRY
DVLAGHDPAGTSFRNVAHWMQLKLSGKFQKFDFGHKENKKRYGVDYPPIYDLSKIQKEVY
MFVGNNDILADVTDANQTRSELTGAKRVWWKQYTAGHCSFMWSKDMSHMEDVLQILSNQI


>TTHERM_00378810(gene)
ATGAATTAAGTCACTAAAATTTTCTTAATTGTCTTGGCCTTAACTGGAGGAGCTTTGTTG
GTAAACCTCCTCTGGCCTAAGTACCATAAAGAAGCTTGGCTCGAAACCATGGACTACTAC
AAATATTTTGGATATCCTGCAGAAAACCATTATGTCACTACTTCTGATGGATACATTCTT
TAGATATTCAGAATTCAAGCCAAAAATACATAAATCAAGCAAACTGGCTTACCTGTTGTC
TTCTTATAGCATGGTCTTCTTGATAACTCAGATACTTTCTTCATCAACAGCGAAGATAAG
GTGACGCATTTATATAAACTTAGATTTAACACAGAATATTTTGATATAAAATTGTTTTAC
ACAAAAAAATTATAAAAATTAATATTTTTATATTATTTAGTATATATCATTTGGTTACTT
GTTTTATTAAATTAAAATTAATCAAATGTTATAAATAAATAAAGGCACCTGCTTTCATTT
TAGCTAATGCTGGTTATGATGTTTGGATGGGTAACAATAGAGGAAACCGCCACTCAAGAA
ATCACACTACTTACAACCCTGATACTGATAAGGAGTAGTTCTGGGCCTTTACTTACGATG
ATTTCGCTGAAAAGGATTTAGCTAGCATGCTCACTTATGTAACTGATGCCACTGGATAGG
CTTAGCTTGATTATATTGGTCACTCATAGGGTACTACCTAGATGTTTGCTGCTTTAAGTG
AAGGAATTCCAGAAGTAGTTTCTAGAGTTAGAAAATTCCTTGCTTTTGGTCCAGTCACAT
ACATAAACCACGGAAAACCTAACCTACCCGAATCATTTTTACGTTTAGCCAACGTTACTG
AGTTAGTTGAATTATACAATTTTGCAAACTTGATCGACCCTGCCCACAGAGCTGAGAAGA
TGTATGAATGGCTTAAGAACCACACAATATACGAAATTATGCCTTTCAATAAGGTCATTA
GAGATTTAGGTAATATATATATTTACTCTTAATTACACATTAAAAAATATAATATAAATT
TTATAGGATAAATTTAATTCAAATCTTTGTTTATTTGTTACTTTAATTTAGTAATTTTTT
TTTCGTTGTATCGATCGATCTCTATTTAAGCTGCATTTAAAAATCTTTTTGTGAAAGCCT
CATAATTTTTGATAAAGATTTAGTAAATTTGGCTTTTAGACATAGATTTAGAATAATAGA
TATATTAATTATCACACATTTTGCACTTGGATTAAATTAAAAACAAAATAGAAAATTTGC
ATTAATCCTCATCAATTATAAACAATTTTACTTATTTCTCAATAAAAATAAGATATTTAT
TTTAAATAATACCATAAAACCTCGATAAGAAAGCCGAATAATATTGAGGTATTTGAAAAA
TAAGGATAAGTTAAAATTTAATTTAAAAATAGCATTTTAAAAAATAAAATCCTAAAATTT
AAATAATTTATGGATATATATTTTTAAAAATTAAATGTTATATTTTTTTACAAAAGTTTA
TTAATTTATTTATTTTATATTTTATTAAAATAAATTTATTTTGTAGGTATTGAATTTTGT
GGTAAATTCCCTTTACCTTGTGGTAAGCTTGTTGGTGCAATTACAAGCAATGATTATAGA
ATTGACAACTATGATAGATATGATGTTTTAGCAGGTCATGATCCTGCTGGTACTTCTTTC
AGAAATGTAGCTCACTGGATGCAATTAAAATTATCAGGAAAATTCTAAAAGTTTGATTTT
GGTCATAAGGAAAACAAAAAGAGATATGGAGTTGATTATCCTCCTATTTATGATTTAAGC
AAAATTTAAAAAGAAGTCTATATGTTTGTTGGAAATAATGATATTTTAGCTGATGTAACT
GATGCTAACTAAACTCGTAGTGAATTAACAGGAGCCAAGAGAGTTTGGTGGAAGTAATAC
ACTGCTGGTCACTGCTCTTTTATGTGGTCTAAGGATATGTCCCATATGGAGGATGTATTA
TAAATTCTTAGTAACCAGATCTGA