Identifiers and Description

Gene Model Identifier

TTHERM_00701020

Standard Name

TGL5 (TriGlyceride Lipase)

Aliases

PreTt14899 | 109.m00117

Description

TGL5 Ab-hydrolase associated lipase region protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00561 ) hydrolase, alpha/beta fold family
  • ( PF04083 ) ab-hydrolase associated lipase region

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 89.3%

TetraMine Data

TTHERM_00701020

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01231.19.997093137033517e-262ab-hydrolase associated lipase
region family protein (405 aa
)
OxytrichaContig11487.0.g499.996162112727537e-67Partial alpha/beta-hydrolase l
ipase region
WormBaseWBGene000219632.000597631390999e-64locus:lipl-6 status:Partiall
y_confirmed UniProt:E2S7J2
protein_id:CCD72909.1
DictyBaseDDB_G02689666.001502944943701e-53lip1 on chromosome: 1 position
2042126 to 2043871
Stentor CoeruleusSteCoe_295203.0144087850653746e-40
SGDYKL140W2.000470901975128e-28TGL1 Steryl ester hydrolase, o
ne of three gene products (Yeh
1p, Yeh2p, Tgl1p) responsible
for steryl ester hydrolase act
ivity and involved in sterol h
omeostasis; localized to lipid
particle membranes

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00701020(coding)
ATGAAATTATAAGCTAGCCTATTCATTTTTACTTTGCTACTTCTTAGCTAAGTTCAAAGT
TAACAATTATCTGATGATGATATCAAAGAACTAGCTAATGATTCTTTTGTTCAGATTTGT
CAAAAGTACAATTATCCAGTAGAAATCCACAAAATAACCACTTAAGATGGATACATTTTG
ACATATTATCGTATTTAAAGACCAGGAACTACAATTGTCTCTAATTTACCAGTTGTATAT
CTTCAACATGGTTTGGTAGACTCAAGTTTTGACTTCATTATCAACGAAGTTACAAAGGCA
CCAGGATTCATTCTTGCCAATTAAGGTTTTGATGTTTGGATGGGTAACTCTAGAGGTAAT
GATCAATCATTAGAGCACATTTCCCTCAATTGGTAGACTGATCCTGAATACTGGAACTTC
TCATGGTAAGAAATGAGCAAGTATGACCTCCCAGCTGCCTTTAGCTATATTGCTAATGTT
ACATAAGCTGAAAAGATTGATTATATTGGTCATTCACAAGGTACATCAATTATGTTTGCT
TCTTTATCTGAAAAAGACCCAATTGTTAGCAAATATCTTGGCAAATTTATAGCTATGGGT
CCTGTAGCATACGTAAATCACTCAGATGCTATGTTCATTGATTTAATTAAAAAAGTTAAG
TTGACTGCTTTACTCCGTAAATTTAATATTAATTATGTGATGATGCCAAACTAGAAAGTT
AACTCTTTTGTTCAACTAGTATGTGCATATTTCCCTAGCTTTTGTGGTTTGTTTGATTAA
GCATTAGCAAATTTTGACCCTAAAACTGATAACTTAGAAAGATTTAAAGTCATTCTTGGG
CATTACCCAACTAGTACTAGTTCAAGAACTATTGAGCATTGGTAATAAATGCTCAACAAC
AAGAAGGATGCTTCCATGAAAAAATTTGATTATGGATTAATTGGAAATTTGAAGAAATAT
GGTTCTATTCATGCTCCTGAATATGATATTAGCAGTATTACATAGAAAGTCTACTTAGTT
GCAGGTGCTTATGATAGAATAGCTGATATTACAGATGCAACTTTATTACACAATAAGTTG
TAGAATTCAGAAATGTATGTTATTGAAGGTGGTCATGGCACATTTATGTGGGCTAGGGAT
ATTTCCTATTTCTACTAAATAGTTACTCCCATTTTACATAACAAAACTCCTTTAGTTCCT
CCTGCTTCTTCTTGA


>TTHERM_00701020(protein)
MKLQASLFIFTLLLLSQVQSQQLSDDDIKELANDSFVQICQKYNYPVEIHKITTQDGYIL
TYYRIQRPGTTIVSNLPVVYLQHGLVDSSFDFIINEVTKAPGFILANQGFDVWMGNSRGN
DQSLEHISLNWQTDPEYWNFSWQEMSKYDLPAAFSYIANVTQAEKIDYIGHSQGTSIMFA
SLSEKDPIVSKYLGKFIAMGPVAYVNHSDAMFIDLIKKVKLTALLRKFNINYVMMPNQKV
NSFVQLVCAYFPSFCGLFDQALANFDPKTDNLERFKVILGHYPTSTSSRTIEHWQQMLNN
KKDASMKKFDYGLIGNLKKYGSIHAPEYDISSITQKVYLVAGAYDRIADITDATLLHNKL
QNSEMYVIEGGHGTFMWARDISYFYQIVTPILHNKTPLVPPASS


>TTHERM_00701020(gene)
ATGAAATTATAAGCTAGCCTATTCATTTTTACTTTGCTACTTCTTAGCTAAGTTCAAAGT
TAACAATTATCTGATGATGATATCAAAGAACTAGCTAATGATTCTTTTGTTCAGATTTGT
CAAAAGTACAATTATCCAGTAGAAATCCACAAAATAACCACTTAAGATGGATACATTTTG
ACATATTATCGTATTTAAAGACCAGGAACTACAATTGTCTCTAATTTACCAGTTGTATAT
CTTCAACATGGTTTGGTAGACTCAAGTTTTGACTTCATTATCAACGAAGTTACAAAGGTA
TAAAATATTTATTTTTTATGCATTTTAATTGATAAATTATCTTGATTATAGGCACCAGGA
TTCATTCTTGCCAATTAAGGTTTTGATGTTTGGATGGGTAACTCTAGAGGTAATGATCAA
TCATTAGAGCACATTTCCCTCAATTGGTAGACTGATCCTGAATACTGGAACTTCTCATGG
TAAGAAATGAGCAAGTATGACCTCCCAGCTGCCTTTAGCTATATTGCTAATGTTACATAA
GCTGAAAAGATTGATTATATTGGTCATTCACAAGGTATTTAGTTATTCTTAAACCAACTA
CATCAAATTAAAATCTATTACTAAATAACAAAAAAGGTACATCAATTATGTTTGCTTCTT
TATCTGAAAAAGACCCAATTGTTAGCAAATATCTTGGCAAATTTATAGCTATGGGTCCTG
TAGCATACGTAAATCACTCAGATGCTATGTTCATTGATTTAATTAAAAAAGTTAAGTTGA
CTGCTTTACTCCGTAAATTTAATATTAATTATGTGATGATGCCAAACTAGGTAATAAAGC
TTAATAATTTTTCTATTATATTATGCAAAATCTATCTATAAATATTTCTTTTACTGCTCC
AAAATTAAAAATAAATAATAAGTAAACACATAAGATTAAAGTATTAGCAATTACTTACCA
CTTCGAAAATACCTTCACTCTAATTTCTATAAAAACAATAAATCAAACACATTTATTTAA
CTTTGTATTTTAATTAGTTAGGAAGCTTTTTTCTTTATATTGATTTTCAGAAACCTTTTA
TTTAAGTGATAAATGATTCAATAAAAGTATAAATGATGCATTTATATACAAGTATTTTTT
TGATTACACTTTATTAAATAATTAAATGCATCGTAAATCTTACTTAAAATAAATAAGGTT
TTTTATAAAAGAATTTCATTATTTTAATCATGACTAATCACCACAAATAAATAAGCAAAT
ATTAAATGAATTTAAATAAAATTAATAACAAGTATAATAAATATACTTGTCATATTTTAA
ATCTATTCTAGTGATTAAAAATTATTTTTATTTAAATAGAAAGTTAACTCTTTTGTTCAA
CTAGTATGTGCATATTTCCCTAGCTTTTGTGGTTTGTTTGATTAAGCATTAGCAAATTTT
GACCCTAAAACTGATAACTTAGAAAGATTTAAAGTCATTCTTGGGCATTACCCAACTAGT
ACTAGTGTATGATTAAATTATATTAATTAGAAATACTCCAAAAATTATATTTTTAAAAAT
AGTCAAGAACTATTGAGCATTGGTAATAAATGCTCAACAACAAGAAGGATGCTTCCATGA
AAAAATTTGATTATGGATTAATTGGAAATTTGAAGAAATATGGTTCTATTCATGCTCCTG
AATATGATATTAGCAGTATTACATAGAAAGTCTACTTAGTTGCAGGTGCTTATGATAGAA
TAGCTGATATTACAGATGCAACTTTATTACACAATAAGTTGTAGAATTCAGAAATGTATG
TTATTGAAGGTGGTCATGGCACATTTATGTGGGCTAGGGATATTTCCTATTTCTACTAAA
TAGTTACTCCCATTTTACATAACAAAACTCCTTTAGTTCCTCCTGCTTCTTCTTGA