Identifiers and Description

Gene Model Identifier

TTHERM_00570540

Standard Name

TGL4 (TriGlyceride Lipase)

Aliases

PreTt10483 | 76.m00185 | 3810.m02045

Description

ab-hydrolase associated lipase region family protein; Steryl ester hydrolase, similar to yeast TGL1, YEH1 and YEH2 steryl ester hydrolases

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.4%

TetraMine Data

TTHERM_00570540

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03455.19.997093137033517e-262ab-hydrolase associated lipase
region family protein (445 aa
)
OxytrichaContig10401.0.g793.999413844471248e-84Partial alpha/beta-hydrolase l
ipase region
WormBaseWBGene000219639.004195835458823e-61locus:lipl-6 status:Partiall
y_confirmed UniProt:E2S7J2
protein_id:CCD72909.1
DictyBaseDDB_G02760837.001368147796582e-60lip4 on chromosome: 2 position
6415536 to 6416900
Stentor CoeruleusSteCoe_301079.854154686111257e-34
SGDYKL140W6.001249495680822e-29TGL1 Steryl ester hydrolase, o
ne of three gene products (Yeh
1p, Yeh2p, Tgl1p) responsible
for steryl ester hydrolase act
ivity and involved in sterol h
omeostasis; localized to lipid
particle membranes

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00570540(coding)
ATGCAAATAATCAAGAATTACTAGTCTAAAAATACTTAGAGAAGAAGCTTCATCGTAAAG
AAGAGATTCGCAGCACTTCTTTTCGGGTTAATGATCTCATACCTCTATTTACCTCGAGAT
TTCTTTGGTACTCTCCATTAAGAGACCCATATGGAGTTCGAGGACTATGTTCGCTATTAC
AAATATCCCATCCAACGTCATGAAGTCGCTACTCCAGATGGATACATATTAACTGTTTTC
AGAATTCAAGCTAAGTATTAAAAAGAGTTTAAATAAGGTCTACCTGTAGTTTACCTTCAG
CACGGTCTATTGGATTCCAGTGATTCATTCATAGTCAACTAAGAAAGTAAAGCTCCTGCT
TTCATGCTGGCTAATCGCGGGTATGATGTTTGGCTCGGAAATTTCAGAGGAAACAAACAT
TCTCGCAGCCATGTCATTCTTAATCCTGAATCTCCCAATAAGGAAGAAGTGCGTCGCTTC
TGGAATTTCTCTTTTCATGAAATGGGCGTTATTGATATTCCTTCTATATTTGAATATATC
CATAACTTCACTGATCGTAAAATAAACTTTATAGGCCATTCTTAAGGATCTATGTCTATG
TTTGTAGCTCTTACTGAAGAGCATCCCGTAGTCAAAGCTTACATTAATTAGTTCATAGCT
TTAGGACCTATTGCTTATATCTAGCATGTTACTTCTATACCTCTTTAACTCTATAATTTT
GCACGCTAATTTATTGATTTAACATAACTTCTTTACAAAATTGAATTTTACGAATTCATT
CCTTCTACTTGGTTTACCACTGAGGTTGTTTCCCGCTTTTGCAATGTCTTCCCTCTTGCT
TGCTCTTACGCTTACGGTTTAGTAGGATCAATCGACCCTATGCTAGACTAAAATGACCGC
TACGATGTTATTTCTGCACACATACCCTCAGGAACTTCTCTCAAAAATATGATGCATTTT
CATCAACTTATTTCTACTTACGAATTCAAAAGATTTGACTATGGCCCTGAAAAGAATATG
AAATACTATGGATAAAAGACTGCTCCTTTCTATGACCTTAGCAAAATAAATATTCCTGTT
GCTCTTTTCTTAGGCACAGAAGATAGATTAGCTGTCAAAGAAGATGTTCTAAGATTAAAG
AGAGAACTATCTAACGCTTCGGAGCTTTATTTCTAAGAAATCCACTCTGGACATACTTCT
TTCATGTGGGGCAAAGATATGAGTTATTTCGAAGAAGTTTTTAATTTACTTGAAACTCAT
GATTTTCATGATCTGAATTACTACACATAAAGTACTAAATTGACATCTGCATCTTAAAAA
AATATCACTAACTCATCATTAACAATTGAAAATTAATGA


>TTHERM_00570540(protein)
MQIIKNYQSKNTQRRSFIVKKRFAALLFGLMISYLYLPRDFFGTLHQETHMEFEDYVRYY
KYPIQRHEVATPDGYILTVFRIQAKYQKEFKQGLPVVYLQHGLLDSSDSFIVNQESKAPA
FMLANRGYDVWLGNFRGNKHSRSHVILNPESPNKEEVRRFWNFSFHEMGVIDIPSIFEYI
HNFTDRKINFIGHSQGSMSMFVALTEEHPVVKAYINQFIALGPIAYIQHVTSIPLQLYNF
ARQFIDLTQLLYKIEFYEFIPSTWFTTEVVSRFCNVFPLACSYAYGLVGSIDPMLDQNDR
YDVISAHIPSGTSLKNMMHFHQLISTYEFKRFDYGPEKNMKYYGQKTAPFYDLSKINIPV
ALFLGTEDRLAVKEDVLRLKRELSNASELYFQEIHSGHTSFMWGKDMSYFEEVFNLLETH
DFHDLNYYTQSTKLTSASQKNITNSSLTIENQ


>TTHERM_00570540(gene)
ATGCAAATAATCAAGAATTACTAGTCTAAAAATACTTAGAGAAGAAGCTTCATCGTAAAG
AAGAGATTCGCAGCACTTCTTTTCGGGTTAATGATCTCATACCTCTATTTACCTCGAGAT
TTCTTTGGTACTCTCCATTAAGAGACCCATATGGAGTTCGAGGACTATGTTCGCTATTAC
AAATATCCCATCCAACGTCATGAAGTCGCTACTCCAGATGGATACATATTAACTGTTTTC
AGAATTCAAGCTAAGTATTAAAAAGAGTTTAAATAAGGTCTACCTGTAGTTTACCTTCAG
CACGGTCTATTGGATTCCAGTGATTCATTCATAGTCAACTAAGAAAGTAAAGCTCCTGCT
TTCATGCTGGCTAATCGCGGGTATGATGTTTGGCTCGGAAATTTCAGAGGAAACAAACAT
TCTCGCAGCCATGTCATTCTTAATCCTGAATCTCCCAATAAGGAAGAAGTGCGTCGCTTC
TGGAATTTCTCTTTTCATGAAATGGGCGTTATTGATATTCCTTCTATATTTGAATATATC
CATAACTTCACTGATCGTAAAATAAACTTTATAGGCCATTCTTAAGGATCTATGTCTATG
TTTGTAGCTCTTACTGAAGAGCATCCCGTAGTCAAAGCTTACATTAATTAGTTCATAGCT
TTAGGACCTATTGCTTATATCTAGCATGTTACTTCTATACCTCTTTAACTCTATAATTTT
GCACGCTAATTTATTGATTTAACATAACTTCTTTACAAAATTGAATTTTACGAATTCATT
CCTTCTACTTGGTTTACCACTGAGGTTGTTTCCCGCTTTTGCAATGTCTTCCCTCTTGCT
TGCTCTTACGCTTACGGTTTAGTAGGATCAATCGACCCTATGCTAGACTAAAATGACCGC
TACGATGTTATTTCTGCACACATACCCTCAGGAACTTCTCTCAAAAATATGATGCATTTT
CATCAACTTATTTCTACTTACGAATTCAAAAGATTTGACTATGGCCCTGAAAAGAATATG
AAATACTATGGATAAAAGACTGCTCCTTTCTATGACCTTAGCAAAATAAATATTCCTGTT
GCTCTTTTCTTAGGCACAGAAGATAGATTAGCTGTCAAAGAAGATGTTCTAAGATTAAAG
AGAGAACTATCTAACGCTTCGGAGCTTTATTTCTAAGAAATCCACTCTGGACATACTTCT
TTCATGTGGGGCAAAGATATGAGTTATTTCGAAGAAGTTTTTAATTTACTTGAAACTCAT
GATTTTCATGATCTGAATTACTACACATAAAGTACTAAATTGACATCTGCATCTTAAAAA
AATATCACTAACTCATCATTAACAATTGAAAATTAATGA