Identifiers and Description

Gene Model Identifier

TTHERM_00013720

Standard Name

TGL2 (TriGlyceride Lipase)

Aliases

PreTt11878 | 1.m00926

Description

TGL2 Ab-hydrolase associated lipase region protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00561 ) hydrolase, alpha/beta fold family
  • ( PF04083 ) ab-hydrolase associated lipase region

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 77.2%

TetraMine Data

TTHERM_00013720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02679.19.997093137033517e-262ab-hydrolase associated lipase
region family protein (395 aa
)
OxytrichaContig10401.0.g791.0001478224244938e-84Partial alpha/beta-hydrolase l
ipase region
WormBaseWBGene000100623.999329394025902e-72locus:lipl-1 Lipase status
:Confirmed UniProt:Q93789
protein_id:CAB01973.1
DictyBaseDDB_G02689661.999618694399617e-70lip1 on chromosome: 1 position
2042126 to 2043871
SGDYKL140W8.996347186365117e-39TGL1 Steryl ester hydrolase, o
ne of three gene products (Yeh
1p, Yeh2p, Tgl1p) responsible
for steryl ester hydrolase act
ivity and involved in sterol h
omeostasis; localized to lipid
particle membranes
Stentor CoeruleusSteCoe_295202.4426007377405277e-36

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00013720(coding)
ATGAACTATAAGACCCTCCTTATAGCTCTTTGCTTGTTTGCAATTTGCACTTGCGACTTA
TCCTACTTGAGAATGGATGATCAAAATGTCGCACTTCCTTCACCAGACAGGAACTTACCC
ACTGCTGAGTACTTGGCCTACCATAAATATCCTCTTGAAGTTCACTATGTCACCACTGAA
GATGGCTACATTCTCAAGTACAACCGTATTCAAGCCAAAAAATCTAAAATCGTATCTGGA
AAGAAACCTATTTTCCTTCAACACGGTTTGCTTGACTGCTCTGATACTTGGATAATTAAT
GAAGAAAAGCTTGCACCAGCTTTCATCTTAGCTAATGCAGGTTATGATGTCTGGATGGGT
AATAGCAGAGGTAACATGTTTGGAAGAAACCACACAACCTTAAACCCAGATACTGATAAG
GCTTTTTGGAATTTCTCCTTCGACGAAATGTCTAAGTATGATTTACCTGCTGGCTTTGCT
TACATCGCCAACGTTACTGGCTTTGATAAAATTCATTATGTTGGTCACTCTTAAGGTTCC
ACCACAATGTTCATCGCTTTATCAACCAGAAATCAAGGAGTTCTCAAATACCTTGACAAG
GTTGCTGCTTTCGGACCTGTTGCTAAAGTTAAAAATGAGTACAGTAAGGTATTGTCTGCT
CTTGCTGACTACAATGTTGACTGGCTTATGTATGCCTTAGGTATCCATGAAGTATTTGCC
TACAGTTGGTTGAAGCATCCTTTCCTCGAAACTGTATGTGGTTTCTTGGGAAAAGTATGC
AGAGCTTTCCTTGGTCCTATTGCTGATACTGATCCTAAAGTAGATAACTACAAGAGAATG
GACGTACTTGTAGGACATGACCCTGCTGGTACCAGCTTAATGAACATGGAACACTGGAAA
CAAATGGTCAAGTAAGGAAACTTCTAAGCTTATGATTATGGTGCTATTGAAAATTTAAAG
AAGTATCACTCTCTTAAGGCTCCTCTTTATGATTTAACTAAAATCCAAGAAAAAGTTTAC
TTGTTTGCTGGTTCCACAGATAGCTTGGCTGACCCAACTGATGTTGCCTGGATGAGAACT
CAACTCCCCAACTTCTGGTTCAAAGAATATAACTATGGTCACTGCACTTTTATGTGGGGT
ATCAGCAATGAACACATGGATGACCTCTTAAACATTCTCCAAGGTCAAGATCCTACTCCT
ACTCCCTCTTCTTAATGA


>TTHERM_00013720(protein)
MNYKTLLIALCLFAICTCDLSYLRMDDQNVALPSPDRNLPTAEYLAYHKYPLEVHYVTTE
DGYILKYNRIQAKKSKIVSGKKPIFLQHGLLDCSDTWIINEEKLAPAFILANAGYDVWMG
NSRGNMFGRNHTTLNPDTDKAFWNFSFDEMSKYDLPAGFAYIANVTGFDKIHYVGHSQGS
TTMFIALSTRNQGVLKYLDKVAAFGPVAKVKNEYSKVLSALADYNVDWLMYALGIHEVFA
YSWLKHPFLETVCGFLGKVCRAFLGPIADTDPKVDNYKRMDVLVGHDPAGTSLMNMEHWK
QMVKQGNFQAYDYGAIENLKKYHSLKAPLYDLTKIQEKVYLFAGSTDSLADPTDVAWMRT
QLPNFWFKEYNYGHCTFMWGISNEHMDDLLNILQGQDPTPTPSSQ


>TTHERM_00013720(gene)
ATGAACTATAAGACCCTCCTTATAGCTCTTTGCTTGTTTGCAATTTGCACTTGCGACTTA
TCCTACTTGAGAATGGATGATCAAAATGTCGCACTTCCTTCACCAGACAGGAACTTACCC
ACTGCTGAGTACTTGGCCTACCATAAATATCCTCTTGAAGTTCACTATGTCACCACTGAA
GATGGCTACATTCTCAAGTACAACCGTATTCAAGCCAAAAAATCTAAAATCGTATCTGGA
AAGAAACCTATTTTCCTTCAACACGGTTTGCTTGACTGCTCTGATACTTGGATAATTAAT
GAAGAAAAGCTTGTAATACAAATTTATTCATACTTATTAAACTTTTATAAGTAGTACTTG
TATTAGAACCACGCATAACTAACTTATAAAAAACAAACAATCCCTCTTTACTTTATTTTA
GAAAAAAAGTTTATTTTAAAAATATAAAAACATACATAAAAAATAAAATTTTATTTTATG
CTATGCGCTTTTATTCTTTTTGAAAAATCTGACTGACACTCATTTATTTATTTATTAGCT
CTAATTTAATTTATTTACTCATTTTTATTATAAAAAAGGCACCAGCTTTCATCTTAGCTA
ATGCAGGTTATGATGTCTGGATGGGTAATAGCAGAGGTAACATGTTTGGAAGAAACCACA
CAACCTTAAACCCAGATACTGATAAGGCTTTTTGGAATTTCTCCTTCGACGAAATGTCTA
AGTATGATTTACCTGCTGGCTTTGCTTACATCGCCAACGTTACTGGCTTTGATAAAATTC
ATTATGTTGGTCACTCTTAAGGTTCCACCACAATGTTCATCGCTTTATCAACCAGAAATC
AAGGAGTTCTCAAATACCTTGACAAGGTTGCTGCTTTCGGACCTGTATTTATTAATTTAA
ATTTCAATTGTTTTGGATTAATTTAATTCATTTCATAATGGTTTAAACAGCAAAAAATTG
TTATTTGTTCTTTCTTTAGAAATATAAAGCAAATAAAAAAACAAGCAAACAAGCAAACAA
ATAAACAATAGAATTTTAATTTAACTAAATTTTCTGATTTTGGTGTTTAAAATCTTGAAG
TTAAAGTGATGCAATAATTATCCTATTCTTAGTTGATTTTAATTAAATTAAAAAACAAAA
TAGATTATTACTGAATTAATTTGAAAGATGTGAATTTGTTCTAATACAAATTATAGCAAA
ATTCTTCTACTTCTCCTTAAAATTTTTAATAATTAATTAAAACTCTAAGATGAAAAATAA
AATTGCATCTTGATATCAAATGATTTTTTGTTTTATTTTTACATATTTTTATTTTGTAAA
CAGGTTGCTAAAGTTAAAAATGAGTACAGTAAGGTATTGTCTGCTCTTGCTGACTACAAT
GTTGACTGGCTTATGTATGCCTTAGGTATCCATGAAGTATTTGCCTACAGTTGGTTGAAG
CATCCTTTCCTCGAAACTGTATGTGGTTTCTTGGGAAAAGTATGCAGAGCTTTCCTTGGT
CCTATTGCTGATACTGATCCTAAAGTAGATAACTACAAGGTAAATTTTATCAATTATTTT
ATCTTTTATCTTTAATTTTCATTCTATAAATTAACTAATTCAATAAAAATAATTTATTTT
TTTAATTAAATAAAGAGAATGGACGTACTTGTAGGACATGACCCTGCTGGTACCAGCTTA
ATGAACATGGAACACTGGAAACAAATGGTCAAGTAAGGAAACTTCTAAGCTTATGATTAT
GGTGCTATTGAAAATTTAAAGAAGTATCACTCTCTTAAGGCTCCTCTTTATGATTTAACT
AAAATCCAAGAAAAAGTTTACTTGTTTGCTGGTTCCACAGATAGCTTGGCTGACCCAACT
GATGTTGCCTGGATGAGAACTCAACTCCCCAACTTCTGGTTCAAAGAATATAACTATGGT
CACTGCACTTTTATGTGGGGTATCAGCAATGAACACATGGATGACCTCTTAAACATTCTC
CAAGGTCAAGATCCTACTCCTACTCCCTCTTCTTAATGA