Identifiers and Description

Gene Model Identifier

TTHERM_00143570

Standard Name

TGL10 (TriGlyceride Lipase)

Aliases

PreTt26664 | 11.m00361 | 3702.m00084

Description

TGL10 ab-hydrolase associated lipase region family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF05448 ) Acetyl xylan esterase (AXE1)
  • ( PF00561 ) hydrolase, alpha/beta fold family
  • ( PF04083 ) ab-hydrolase associated lipase region

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 22.7%

TetraMine Data

TTHERM_00143570

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04814.19.997093137033517e-262ab-hydrolase associated lipase
region family protein (381 aa
)
OxytrichaContig11487.0.g493.0013534825799953e-36Partial alpha/beta-hydrolase l
ipase region
WormBaseWBGene000219634.999350823993609e-33locus:lipl-6 status:Partiall
y_confirmed UniProt:E2S7J2
protein_id:CCD72909.1
DictyBaseDDB_G02760832.0009605191578312e-25lip4 on chromosome: 2 position
6415536 to 6416900
SGDYKL140W1.999598840915195e-17TGL1 Steryl ester hydrolase, o
ne of three gene products (Yeh
1p, Yeh2p, Tgl1p) responsible
for steryl ester hydrolase act
ivity and involved in sterol h
omeostasis; localized to lipid
particle membranes
Stentor CoeruleusSteCoe_60690.0000000000018795288165390832

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00143570(coding)
ATGAGCTATATCAAAAAATCAGTAAAAGGAATTTTGATTTCTATATTTTTCTATCTGATG
TTCATTTATGAAAGCGAAGAAGAGCTTTTTTGGAAGAAGCCTATCGATGAGAGGCTCAGG
CTTTAGCTTTATCCTGTAGAACGTCACTACATATTGACAGAAGATAAATTCAACATAACT
CTCTTTAGGGTTGGTAAGAAAGGATTAAGTTAAGTTAGTACCAGAGGTAAACCTGTTATA
TTCGTGCCTCAATTTCTGAACTGCATAGATACATATGTGTCAAATGAGGATCATCTAGCG
CCAGCACTTGTATTTGCTAATCAGGGATTTGATGTATGGTTGATGAGCCAAAGAGGTGGA
GAGTATTCTCCAAATGAAGATAGATAAGATGGGTTTTCTTTTCATGAAATAGGATATTTT
GACCTTCCTAAATCATATGAATATATTTATTCACTTAATCCTTAAAATATAACAGCAGTT
GGGCATTCATAAGGAGGCAATACAATTTTTGTCTCATTGACTGAGAAAAGATTAAAAAAT
GTACATAAAATAATAATGTTTGCTCCTGGCCCTTTTGCCAAGAATGCTACAGGCTTGATT
CCATATTTTGTAAGCTCTCGTTTTGTGGATATTTTAGCTAAATACACCGATAGAATAAAC
CTTACTCCCAGTAAGTATCTATTTAAGCTTTGCAAATACTTCCATCTTCCCTCTAAACTA
TTTTTAACTACAGTAACTGACACATGGGAAAGTGATATGAATATAGCAAAGCTATATTAA
TACACAAAGCATTCCCCATAGCCCTAATCAATAAAAAATCTTTTACATTTAAAATAATTA
TTGATAAAAGGTTAATTTTATAAATATGATTATGGCTAAGAGTAAAATTTGAAAATCTAT
GGTTAAGAAGAAGCTCCTCTTTATGATTTGCTTTCAATCACAGAAAGTATTCATCTATTT
TATGGTCCTCATGATATATTAACTAGGTATCCAGATAATATTGAGCTTTATGAAATTTTG
AAAAAAAGCTAAGCAAAAAACGTTACTTTTAGTTATTATCCTACCGTAGGTCACGTTAGT
TTTATATTAGATTCAAAAGCTGAGTTTTTATAAGAAATGATTAAGATAATTGAAGAAGAT
TGA


>TTHERM_00143570(protein)
MSYIKKSVKGILISIFFYLMFIYESEEELFWKKPIDERLRLQLYPVERHYILTEDKFNIT
LFRVGKKGLSQVSTRGKPVIFVPQFLNCIDTYVSNEDHLAPALVFANQGFDVWLMSQRGG
EYSPNEDRQDGFSFHEIGYFDLPKSYEYIYSLNPQNITAVGHSQGGNTIFVSLTEKRLKN
VHKIIMFAPGPFAKNATGLIPYFVSSRFVDILAKYTDRINLTPSKYLFKLCKYFHLPSKL
FLTTVTDTWESDMNIAKLYQYTKHSPQPQSIKNLLHLKQLLIKGQFYKYDYGQEQNLKIY
GQEEAPLYDLLSITESIHLFYGPHDILTRYPDNIELYEILKKSQAKNVTFSYYPTVGHVS
FILDSKAEFLQEMIKIIEED


>TTHERM_00143570(gene)
ATGAGCTATATCAAAAAATCAGTAAAAGGAATTTTGATTTCTATATTTTTCTATCTGATG
TTCATTTATGAAAGCGAAGAAGAGCTTTTTTGGAAGAAGCCTATCGATGAGAGGCTCAGG
CTTTAGCTTTATCCTGTAGAACGTCACTACATATTGACAGAAGATAAATTCAACATAACT
CTCTTTAGGGTTGGTAAGAAAGGATTAAGTTAAGTTAGTACCAGAGGTAAACCTGTTATA
TTCGTGCCTCAATTTCTGAACTGCATAGATACATATGTGTCAAATGAGGATCATCTAGCG
CCAGCACTTGTATTTGCTAATCAGGGATTTGATGTATGGTTGATGAGCCAAAGAGGTGGA
GAGTATTCTCCAAATGAAGATAGATAAGATGGGTTTTCTTTTCATGAAATAGGATATTTT
GACCTTCCTAAATCATATGAATATATTTATTCACTTAATCCTTAAAATATAACAGCAGTT
GGGCATTCATAAGGAGGCAATACAATTTTTGTCTCATTGACTGAGAAAAGATTAAAAAAT
GTACATAAAATAATAATGTTTGCTCCTGGCCCTTTTGCCAAGAATGCTACAGGCTTGATT
CCATATTTTGTAAGCTCTCGTTTTGTGGATATTTTAGCTAAATACACCGATAGAATAAAC
CTTACTCCCAGTAAGTATCTATTTAAGCTTTGCAAATACTTCCATCTTCCCTCTAAACTA
TTTTTAACTACAGTAACTGACACATGGGAAAGTGATATGAATATAGCAAAGCTATATTAA
TACACAAAGCATTCCCCATAGCCCTAATCAATAAAAAATCTTTTACATTTAAAATAATTA
TTGATAAAAGGTTAATTTTATAAATATGATTATGGCTAAGAGTAAAATTTGAAAATCTAT
GGTTAAGAAGAAGCTCCTCTTTATGATTTGCTTTCAATCACAGAAAGTATTCATCTATTT
TATGGTCCTCATGATATATTAACTAGGTATCCAGATAATATTGAGCTTTATGAAATTTTG
AAAAAAAGCTAAGCAAAAAACGTTACTTTTAGTTATTATCCTACCGTAGGTCACGTTAGT
TTTATATTAGATTCAAAAGCTGAGTTTTTATAAGAAATGATTAAGATAATTGAAGAAGAT
TGA