Identifiers and Description

Gene Model Identifier

TTHERM_00723090

Standard Name

TGL1 (TriGlyceride Lipase 1)

Aliases

PreTt18069 | 116.m00094 | 3671.m00018

Description

ab-hydrolase associated lipase region family protein; Steryl ester hydrolase; involved in sterol homeostasis; similar to yeast TGL1, YEH1 and YEH2 steryl ester hydrolases

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03810 ) Importin-beta N-terminal domain
  • ( PF00561 ) hydrolase, alpha/beta fold family
  • ( PF04083 ) ab-hydrolase associated lipase region
  • ( PF06021 ) Aralkyl acyl-CoA:amino acid N-acyltransferase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13%

TetraMine Data

TTHERM_00723090

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14788.19.997093137033517e-262ab-hydrolase associated lipase
region family protein (451 aa
)
DictyBaseDDB_G02760835.001742359316081e-68lip4 on chromosome: 2 position
6415536 to 6416900
OxytrichaContig17503.0.g22.0002571866765887e-62Partial alpha/beta-hydrolase l
ipase region
WormBaseWBGene000219633.000235161122315e-61locus:lipl-6 status:Partiall
y_confirmed UniProt:E2S7J2
protein_id:CCD72909.1
SGDYKL140W1.9991939848149086e-44TGL1 Steryl ester hydrolase, o
ne of three gene products (Yeh
1p, Yeh2p, Tgl1p) responsible
for steryl ester hydrolase act
ivity and involved in sterol h
omeostasis; localized to lipid
particle membranes
Stentor CoeruleusSteCoe_295201.185064864233981e-27

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000194

Sequences

>TTHERM_00723090(coding)
ATGAGTGACCCTATTCTAGCATAATTTAAAGAGGCGCTTAGGATATCTCTACTATATTTT
ATTCATTTTGCAGTTTTCATCCAGTGTTTCCTCATGTCCACTCTTCTTTATATCTTAAGA
ATAATTCTACACCTTTTCACAGCAATCCCTCAATTAAAACACTTGAGAAAATCTTTGATG
AGATTTTTACCTTAAATCAATCCTGATGTTTATGCTAAAGCAGAGGATTTAATTATGAGT
CACATTGAATACAACATTGAAACTCATAAAATTCTCACTGAAGATGGTTACTATTTAACA
GCCTGGCGTATTCTTTCTTCAGATAAGAAGAAATCTTAAGAAGCTCGCAGCAAAGCTCCC
GTCATTTTGATGCATGGACTTTTAGATTGCAGTTTTTCTTGGTTTGTTAATAAAGAAAGA
TAGATGTGCTTGCCTTATATTTTGGCAGACTAGGGCTATGACGTTTGGTGCATGAATAAC
CGCGGTAATAGATACTCCTTAGGTCATAAGTACTTCAAACATATTAAATCAAATCCTCAT
TATTGGAACTATGGCTTTGATGAGCTAGCAAAATATGACGTTAAAGCTAATGTCTAATAT
GTTTTAGACACTACAAGCCACTCAAAAGTGTTTTATGTAGGCCACTCTTAAGGCTCTACT
TAAATGTTTGCAAAATTAATGGAAGATCCTTAATTCTAAGAAAAAATTAAAGCTTTCATT
GCTCTCGGTCCAGCTATTTATATTTAAAACTTGGCAAGCAATTTCGTAAAGAAAATGTTT
GGATGTGGTTTCTATCAACTTTTAGATAAATTGGGATACAGAAACTTCTTAGTGCTACCT
AAATCCATTTCTAGAAGAGTTGGAGCACTGTGCCACTATTTACCATTTTTATATGATATC
GGTCTATTTAAAGTTATGAATTTACTTTGCGGCTTCCCTGTTGAAAATAAAATTCCTCGT
GACAAAATTTCAGTTATTGTAACACACGAACCTGGTGGTGCTTCAGTTAGAAATATTTTA
TAATGGGAACAATTCATGAAATCTGGAGAGTTTAAAAAGTTTGATTTTGGAGCTTAAAAG
AATATGAAGGTATATGGATAAACAAAACCTCCTTGCTATAATACAGAGAATCTTAAAAAG
ATAACAATTCCTCAACACTTGTTTATTGGTACTTCAGATATTGTTGGAAATAAAATAGAT
ACTGATCGCTTACTATAACTAGTTAATCCTGATTCTTCCAAGATATATACGCTAAATGAC
TATGCCCATCTTGACTATGTATGGGGAACTGATGCTAACACTGTACTTTACCCCTAAATA
ATAAAAATATTAAAAGCTCACCAAACAACATGA


>TTHERM_00723090(protein)
MSDPILAQFKEALRISLLYFIHFAVFIQCFLMSTLLYILRIILHLFTAIPQLKHLRKSLM
RFLPQINPDVYAKAEDLIMSHIEYNIETHKILTEDGYYLTAWRILSSDKKKSQEARSKAP
VILMHGLLDCSFSWFVNKERQMCLPYILADQGYDVWCMNNRGNRYSLGHKYFKHIKSNPH
YWNYGFDELAKYDVKANVQYVLDTTSHSKVFYVGHSQGSTQMFAKLMEDPQFQEKIKAFI
ALGPAIYIQNLASNFVKKMFGCGFYQLLDKLGYRNFLVLPKSISRRVGALCHYLPFLYDI
GLFKVMNLLCGFPVENKIPRDKISVIVTHEPGGASVRNILQWEQFMKSGEFKKFDFGAQK
NMKVYGQTKPPCYNTENLKKITIPQHLFIGTSDIVGNKIDTDRLLQLVNPDSSKIYTLND
YAHLDYVWGTDANTVLYPQIIKILKAHQTT


>TTHERM_00723090(gene)
TTTTAATTAAAACTATATCTTAAAAAAAGTATTGGATTAAAGTAAGAGCAAAAATTTGAA
AATAACTAGCATCCAACAAACAAGCTATTAATCAATCAAAAAGCTATCCTCAAACATATT
ATAAGCAACTAAAATATTATGAGTGACCCTATTCTAGCATAATTTAAAGAGGCGCTTAGG
ATATCTCTACTATATTTTATTCATTTTGCAGTTTTCATCCAGTGTTTCCTCATGTCCACT
CTTCTTTATATCTTAAGAATAATTCTACACCTTTTCACAGCAATCCCTCAATTAAAACAC
TTGAGAAAATCTTTGATGAGATTTTTACCTTAAATCAATCCTGATGTTTATGCTAAAGCA
GGTATATAACTTAATACATATTTTTTAACGAGTTCGCAGCTTCAAATTAGCGACTCAAAA
ATTTTTTTGGAATTTAATCAAACTATTTTTCTATTTTATAGAGGATTTAATTATGAGTCA
CATTGAATACAACATTGAAACTCATAAAATTCTCACTGAAGATGGTTACTATTTAACAGC
CTGGCGTATTCTTTCTTCAGATAAGAAGAAATCTTAAGAAGCTCGCAGCAAAGCTCCCGT
CATTTTGATGCATGGACTTTTAGATTGCAGTTTTTCTTGGTTTGTTAATAAAGAAAGATA
GATGTGCTTGCCTTATATTTTGGCAGACTAGGGCTATGACGTTTGGTGCATGAATAACCG
CGGTAATAGATACTCCTTAGGTCATAAGTACTTCAAACATATTAAATCAAATCCTCATTA
TTGGAACTATGGCTTTGATGAGCTAGCAAAATATGACGTTAAAGCTAATGTCTAATATGT
TTTAGACACTACAAGCCACTCAAAAGTGTTTTATGTAGGCCACTCTTAAGGCTCTACTTA
AATGTTTGCAAAATTAATGGAAGATCCTTAATTCTAAGAAAAAATTAAAGCTTTCATTGC
TCTCGGTCCAGCTATTTATATTTAAAACTTGGTAATTATTTATTTCTCAACATTTTTGAA
CATCTTAATAAAAAAAAATATTAATACAAAATGAATACTTTGCTTGCTTTAGAAAAAGCA
AAATTTAGAGCAATAAAAAACTAAATATAATTAATTACTATTAAAATAAAATTAATCAAT
TTATATTAAATTTTATTATGAACTTTAATACAGCTAAAATTCTTTTTTAAAAGAATTTAA
AATTGAATTAATTAGAGAGAGTCATTTTTAATAAGAAATAATACTTTTAATCAAATGAAA
TATGATATAATTAATAATAGCAAGCATTAATTCATTACATTAAACTATATTTATTGAGAA
AATATTAAATTAATATTTATTTTTTTATGAATAGGCAAGCAATTTCGTAAAGAAAATGTT
TGGATGTGGTTTCTATCAACTTTTAGATAAATTGGGATACAGAAACTTCTTAGTGCTACC
TAAATCCATTTCTAGAAGAGTTGGAGCACTGTGCCACTATTTACCATTTTTATATGATAT
CGGTCTATTTAAAGTTATGAATTTACTTTGCGGCTTCCCTGTTGAAAATAAAATTCCTCG
TGACAAAATTTCAGTTATTGTAACACACGAACCTGGTGGTGCTTCAGTTAGAAATATTTT
ATAATGGTAATTTACTTACTCTTATATTTGAAATAATAAATTTATTTAATATTGAATATT
CTAAAATTTAATTTTAATCATTAGGGAACAATTCATGAAATCTGGAGAGTTTAAAAAGTT
TGATTTTGGAGCTTAAAAGAATATGAAGGTATATGGATAAACAAAACCTCCTTGCTATAA
TACAGAGAATCTTAAAAAGATAACAATTCCTCAACACTTGTTTATTGGTACTTCAGATAT
TGTTGGAAATAAAATAGATACTGATCGCTTACTATAACTAGTTAATCCTGATTCTTCCAA
GATATATACGCTAAATGACTATGCCCATCTTGACTATGTATGGGGAACTGATGCTAACAC
TGTACTTTACCCCTAAATAATAAAAATATTAAAAGCTCACCAAACAACATGAAAAAAAAA
TGTTAAATTATTATTCTATTTATTTATCAATATTAAAATAAAATATAAATTATAATTTCC
TTCTCTATATCTTCATATACATTAACCTTATTATCTATACATTAATTCTGTATTAAAATA
TCCATTTAAAGTATTCCATAGCTAAATTTCTCATATCAACATCACATTTTTATAAAT