Identifiers and Description

Gene Model Identifier

TTHERM_00691200

Standard Name

TFIIS

Aliases

PreTt02958 | 106.m00098 | 3674.m00011

Description

transcription factor S-II. Interacts with transcription regulator Mediator complex in Tetrahymena.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR01384 ) transcription factor S
  • ( TIGR01784 ) conserved hypothetical protein
  • ( PF01096 ) transcription factor S-II (TFIIS)
  • ( TIGR01385 ) transcription elongation factor S-II
  • ( PF08711 ) Transcription elongation factor S-II protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00691200

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17617.19.997316819378982e-180transcription factor S-II (324
aa)
SGDYDR045C0.0000029996948234116693RPC11 RNA polymerase III subun
it C11; mediates pol III RNA c
leavage activity and is import
ant for termination of transcr
iption; homologous to TFIIS
WormBaseWBGene000120000.00003998524687536623Putative transcription elongat
ion factor S-II status:Parti
ally_confirmed UniProt:P5265
2 protein_id:CAA90943.1
OxytrichaContig14486.0.g340.0004000184047659232Transcription factor S-II (TFI
IS), central domain

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:31280994: Garg J, Saettone A, Nabeel-Shah S, Cadorin M, Ponce M, Marquez S, Pu S, Greenblatt J, Lambert JP, Pearlman RE, Fillingham J (2019) The Med31 Conserved Component of the Divergent Mediator Complex in Tetrahymena thermophila Participates in Developmental Regulation. Current biology : CB 29(14):2371-2379.e6

Sequences

>TTHERM_00691200(coding)
ATGGATCAACTATACACAGAAGATGAATTGACTGAATTCAAAAACGATTTGAGAAAGTTT
AAGGAAATTGGAAATACTAAAGTTTTGGCCATCGTAAAAAGACTTTTTAATTGCCAAATC
ACAGTATAATAATTATAAAACACTAAAATTGCTTAAACTGTGTAATCTCTCTCTACTATG
TCTTGCTTCGATGAAGATGAAGAAGGACAAGAAGCTAAATAAATATGCTCTTAAATTATT
AACAAATGGAAAAAAATAGTTTAAAATGAAAAAAATAAGCAAAATCCTCAAGCCTCAAGC
TAAAAAGCACCACAATTAACTAAATCAAATTCACAAACTGCTACTTTGCCTAGAAGATAA
TCCTCTGGTTAAGGTTCTACTGAAACATTTTTAACTAATGAGGAACCCTAATACAAGACA
GAATCAAAAACTGATCTTCCTACTTATAAAAGTGATATTCGCTAAAAAGGATTAGAAGCT
ATTAACAAAATTTTTATGAAGGTTAAAGATGATATTAATGCTTCTCCTAGAGAATGGATT
GAATTAATTGTAAATCTTGAAAAGAAAATTTTCTCAAGAAATTCCTAAGTAGTTTACTAT
AAATCTTATATTAAAGAAGTCCTTGGTATGTTCTCTTCTAATGAAGTTACCACTGAGGTT
ATTTCTAAAATGTTAAATAAAGAAATTTCACTTTAGGATGTTGCTGAAGCAAAAACTAGT
GTCTTCTTGACTGATAGATAAAGAGCCTAGCAAAAAAAAGCTGTTGAAGATTAGCTTGCT
ACAAGTGATCCAGATTTTTATAACAATATGCGTAGATAGCGTTTACAAGGTCTAGAAGGT
GAATTATGTAAAGGATGTAAGAAAAAAACAGCTTTCTTAGTAAAAGAATTATAGACTCGT
TCATCAGATGAACCTATGACTCGTTTTATGGAATGCAATAGCTGTGGTAAAAGTTGGAAA
GACTGA


>TTHERM_00691200(protein)
MDQLYTEDELTEFKNDLRKFKEIGNTKVLAIVKRLFNCQITVQQLQNTKIAQTVQSLSTM
SCFDEDEEGQEAKQICSQIINKWKKIVQNEKNKQNPQASSQKAPQLTKSNSQTATLPRRQ
SSGQGSTETFLTNEEPQYKTESKTDLPTYKSDIRQKGLEAINKIFMKVKDDINASPREWI
ELIVNLEKKIFSRNSQVVYYKSYIKEVLGMFSSNEVTTEVISKMLNKEISLQDVAEAKTS
VFLTDRQRAQQKKAVEDQLATSDPDFYNNMRRQRLQGLEGELCKGCKKKTAFLVKELQTR
SSDEPMTRFMECNSCGKSWKD


>TTHERM_00691200(gene)
ATGGATCAACTATACACAGAAGATGAATTGACTGAATTCAAAAACGATTTGAGAAAGTTT
AAGGAAATTGGAAATACTAAAGTTTTGGCCATCGTAAAAAGACTTTTTAATTGCCAAATC
ACAGTATAATAATTATAAAACACTAAAATTGCTTAAACTGTGTAATCTCTCTCTACTATG
TCTTGCTTCGATGAAGATGAAGAAGGACAAGAAGCTAAATAAATATGCTCTTAAATTATT
AACAAATGGAAAAAAATAGTTTAAAATGAAAAAAATAAGCAAAATCCTCAAGCCTCAAGC
TAAAAAGCACCACAATTAACTAAATCAAATTCACAAACTGCTACTTTGCCTAGAAGATAA
TCCTCTGGTTAAGGTTCTACTGAAACATTTTTAACTAATGAGGAACCCTAATACAAGACA
GAATCAAAAACTGATCTTCCTACTTATAAAAGTGATATTCGCTAAAAAGGATTAGAAGCT
ATTAACAAAATTTTTATGAAGGTTAAAGATGATATTAATGCTTCTCCTAGAGAATGGATT
GAATTAATTGTAAATCTTGAAAAGAAAATTTTCTCAAGAAATTCCTAAGTAGTTTACTAT
AAATCTTATATTAAAGAAGTCCTTGGTATGTTCTCTTCTAATGAAGTTACCACTGAGGTT
ATTTCTAAAATGTTAAATAAAGAAATTTCACTTTAGGATGTTGCTGAAGCAAAAACTAGT
GTCTTCTTGACTGATAGATAAAGAGCCTAGCAAAAAAAAGCTGTTGAAGATTAGCTTGCT
ACAAGTGATCCAGATTTTTATAACAATATGCGTAGATAGCGTTTACAAGGTCTAGAAGGT
GAATTATGTAAAGGATGTAAGAAAAAAACAGCTTTCTTAGTAAAAGAATTATAGACTCGT
TCATCAGATGAACCTATGACTCGTTTTATGGAATGCAATAGCTGTGGTAAAAGTTGGAAA
GACTGA