Identifiers and Description

Gene Model Identifier

TTHERM_00683400

Standard Name

TFC4 (TFIIIC subunit 4)

Aliases

PreTt16177 | 103.m00168 | 3734.m00080

Description

RNA polymerase III transcription initiation factor complex (TFIIIC) subunit TFC4

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF04702 ) Vicilin N terminal region
  • ( PF00806 ) Pumilio-family RNA binding repeat
  • ( PF06784 ) Uncharacterised protein family (UPF0240)
  • ( TIGR02521 ) type IV pilus biogenesis/stability protein
  • ( TIGR02552 ) type III secretion low calcium

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00683400

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17828.19.997093137033517e-262hypothetical protein (1001 aa)
OxytrichaContig9885.0.g741.999598840915195e-17TPR repeat
DictyBaseDDB_G02783211.000361553249356e-16gtf3C3 on chromosome: 3 positi
on 689224 to 692344
SGDYGR047C9.001232279470736e-16TFC4 One of six subunits of th
e RNA polymerase III transcrip
tion initiation factor complex
(TFIIIC); part of the TauA do
main of TFIIIC that binds BoxA
DNA promoter sites of tRNA an
d similar genes; has TPR motif
s; human homolog is TFIIIC-102
WormBaseWBGene000010250.000030009396760408108locus:dnj-7 status:Partially
_confirmed UniProt:P91189
protein_id:CCD68078.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00683400(coding)
ATGAGTAATAATACCAAACGTGAATATTAAGATGATGATGACGAGGAACATGATAGCGAT
TTAATGAGCGACTTCTCAGATGAAGAAAAGCGTCACAAAGACTTAAAGAGCTAATTTAAA
GGCTAAAGGCAATAAAAGATCCCTCAATAAATTTCATAACTCATTAGTGATGCTAATTCA
AAATATGTCTTTTAAAATCAAATAGACGAAGCCATAGAAATAGCAAAAGAAATTATTAGA
CAATACCCTAGTTTTACAGATTCTTATGATTTGCTTGGAAACATTTTTGAAGAATAAGGT
ATGATGAAAGAAGCTGCTGAATATTAATTCTTGGCTGCTTATTAGAGTAATGCAAATGCG
AAAAAATGGGAGGGTATCGCTTAGTTATATAAAAAGGCAAAATGTTATGATAGTGCTGGC
TATTGCTTTGGGAGAGTTCTTAAAAGCGACACATTAAATACATCTCTTTGGTGTGAGAGA
GCTAAGTGCTACGAACAAACAGGTGAACTTAAAAAAGCAATCAAATGCTTTGAAAGAGTT
ATTAAAATGGACGAAAAGAATTTTGATGCTATAAAAAATTGTGCAAAACTCTATTTGAAA
CTTGATAAGAGTGATGAAAGTATAAAGCTTCTTAAAACAATGATTAAACCAAACGACATG
AATAAGAATTATAATATTATCCACATGATATGTGAAATATTTAACAAAAAATAATAATAT
AAAGAATTGTGCGAATTTTTAGAGGAATACTGTGAGATGAAAGATAAAAACGTTAGAGAA
ACCATTTTAGATGAACTTCCTTTAGCAATTTTAATATTTTATGCTGTTTCACATGCAAAA
CTATAAAATAAGGAGGAATGTGAATTAGGATTTAATTTAATTTTAAGAAGAGAAATGGAA
GAAAATGATGACTTTGTCTCTATCATGGAAGAACTTGCAGAAATGTATGAATCTTCAAAG
GAAGAAGAAAAAGCTCTCTAAATTTACAAAAGATTAATATCACTGCCATTTTTGTAGATG
AATTATCAATAAGTTTGGGAAAAATATGGAACATTATTACTTAAACTTCACGAAAATGAA
GAATCAATCAAAGAAATCGAAGAAATAATTTAAAAATTTCCAGATTCAATTGATTTAAGA
ACCGAGTTGTCTTCAGTATATTAGAGTCTTGGACGTAACTAGGATTCCTTAAAAATTCTT
GAAAATTTACTAAGGGATGACATTGAAGAGAACGACTTCGAAACTAGGAAACAATCGGAC
GAAATCAATTTAGATATTAAAGAAGAGGACATTGACAGATATAGCTACACTGCATCATAT
TAAGATGAAAATAATGATGAAGATGAGTACATCTATTAAAACGATGATGATGATGAAGAT
GATGAAAACTATTAAGACCGAATTAAAGTTGACAAAAAAAATATTTTTGATAGATTTTAT
TTAGATAAATCAGATCAAAAGAAAACTAAGAAAGAAATAGGTGTAGATAATGATGACAAT
GAAGATCAAGATGCAGGTGATGATGATAGCGATTTTAATTATGAAGAAGAGTAGCATAAA
AGAGTTAGTTAGAAAAAATAAGCTTCTAAAATTTCAGGATAATATGATTAAATGAGAGAA
TAAAATGAAATTAAGCCTATGAAAAAGAAAAAACTTAATAGCAGGGTAGAAAAAAAAATA
AAAAATTAAATGGATGATGAGAAAGATGATGAAATCTTCTAAATAAATAAGTATTAACAA
AAAGATTTCTTTGAATAAACTTAAGCCAAAAAGAATGAATTAGCTTAACACTACTCAGTC
AAGAACATGTATCTTGAGTATAAAAAAGGATAAATAATTTTAGATACAACGAAGGAGATT
TCGAAGCATAAACTTGATAAATAGTTCTAGACCTTAAAATAATCCCTTTAGCTTGAAAAG
GAATATAATAATTTAAAAAAATCTGTACTCAATCGTATTTTGATAGAAAGCTAAAAAAAA
GGGTTCCAGAGAAGACTAACAACTCCTAATAACCTAAAGACATTTGATAATCCAAATTAA
ACACTTCTTATTAAAAAGAAAAGACAAATGGAGGAACAAGAAATATTAATGAAAAAAAAA
TTCAAAAAATCAGAAGAACTGACAGCAAAATATTTATAGAATGTTGAAGTTCTTTCTTTA
AAAGTTGGTCATGAAGAATATATTTAATATTTAATTAAAATGCTTAAAGTGTTAGTGAAG
TATGATTGCTATGTAAAAATATCCAAAATTTGTTCATTGGCACATAAGTTGCATGTATGG
AAAGATATAAGATTCTTTGGCTATCAAGAAACTGTTGCAAAATATGGGCTTCTAGCAACT
CTTAAATTAGAGAACTATGATAAAGCTTTTACATACATAAAGTTATTAATTAACAGAAAT
TCAGATAGACTGTATCTTTAAGTTATTTTATGTATTATAATGAGACATATATCTAATGTC
AATATCTACAAAACATTTTTATCAAGAATGGTTAAAAAATCTGATGATTCACCTAAATTT
TTACCAATTGTTGCATGTGGTTTTTTAGAAACAGGAAACTTTGATTTAGCAACTGATGTT
CTTCATACAATACTTAAAAATGATAAAGCAAATTCATTATGTAATTTATCTTTAAGTGTA
TGCTATGCTTAACTAACAACAGCAAGAACAACTTATGAAAAAGAGCAAATGGCTGCTAAA
GCTGTTCATTACATGTAAGCCTACTAATAAACTAGAGGATTGACTAGATAAATGGAAATA
TATTATAATTTAGGTAGATTCTTCATTCATCTTAGCATGAATGAAAAAGCTATTGAAAAC
TTCGAAAATTGTATTTAACTTTTTTCAAGTAAAAATTTGAAAGGAAGCTACACATTAAAC
CCAAAATCTAAAGAAACAGACGAAAAAATACTTTAAAAGGCAATTTATAACTTAATTTTG
CTTCATAAAAATTTAGGTAATTACCAAATAGCCCAATCTTTATTAAGATAATACAATACT
CTAAGTTGA


>TTHERM_00683400(protein)
MSNNTKREYQDDDDEEHDSDLMSDFSDEEKRHKDLKSQFKGQRQQKIPQQISQLISDANS
KYVFQNQIDEAIEIAKEIIRQYPSFTDSYDLLGNIFEEQGMMKEAAEYQFLAAYQSNANA
KKWEGIAQLYKKAKCYDSAGYCFGRVLKSDTLNTSLWCERAKCYEQTGELKKAIKCFERV
IKMDEKNFDAIKNCAKLYLKLDKSDESIKLLKTMIKPNDMNKNYNIIHMICEIFNKKQQY
KELCEFLEEYCEMKDKNVRETILDELPLAILIFYAVSHAKLQNKEECELGFNLILRREME
ENDDFVSIMEELAEMYESSKEEEKALQIYKRLISLPFLQMNYQQVWEKYGTLLLKLHENE
ESIKEIEEIIQKFPDSIDLRTELSSVYQSLGRNQDSLKILENLLRDDIEENDFETRKQSD
EINLDIKEEDIDRYSYTASYQDENNDEDEYIYQNDDDDEDDENYQDRIKVDKKNIFDRFY
LDKSDQKKTKKEIGVDNDDNEDQDAGDDDSDFNYEEEQHKRVSQKKQASKISGQYDQMRE
QNEIKPMKKKKLNSRVEKKIKNQMDDEKDDEIFQINKYQQKDFFEQTQAKKNELAQHYSV
KNMYLEYKKGQIILDTTKEISKHKLDKQFQTLKQSLQLEKEYNNLKKSVLNRILIESQKK
GFQRRLTTPNNLKTFDNPNQTLLIKKKRQMEEQEILMKKKFKKSEELTAKYLQNVEVLSL
KVGHEEYIQYLIKMLKVLVKYDCYVKISKICSLAHKLHVWKDIRFFGYQETVAKYGLLAT
LKLENYDKAFTYIKLLINRNSDRLYLQVILCIIMRHISNVNIYKTFLSRMVKKSDDSPKF
LPIVACGFLETGNFDLATDVLHTILKNDKANSLCNLSLSVCYAQLTTARTTYEKEQMAAK
AVHYMQAYQQTRGLTRQMEIYYNLGRFFIHLSMNEKAIENFENCIQLFSSKNLKGSYTLN
PKSKETDEKILQKAIYNLILLHKNLGNYQIAQSLLRQYNTLS


>TTHERM_00683400(gene)
ATGAGTAATAATACCAAACGTGAATATTAAGATGATGATGACGAGGAACATGATAGCGAT
TTAATGAGGTTATTTATCTTTAGCCATTTACTTTTCATTCAAATAAATTATATGTGATTC
ATTTTAAAATATTTAATTATCTACAGCGACTTCTCAGATGAAGAAAAGCGTCACAAAGAC
TTAAAGAGCTAATTTAAAGGCTAAAGGCAATAAAAGATCCCTCAATAAATTTCATAACTC
ATTAGTGATGCTAATTCAAAATATGTCTTTTAAAATCAAATAGACGAAGTATGAGCTAAT
TTAATATAAGTGTTTTACATTTATCAACAAGATGAATAAATAAAGCATCATCAAAATTTA
AACCCTAAATTTAGAATTTTTCATTTTATTTACTTAATTTATAATATTTTAAACATCATG
TATAAATTTCTAGGCCATAGAAATAGCAAAAGAAATTATTAGACAATACCCTAGTTTTAC
AGATTCTTATGATTTGCTTGGAAACATTTTTGAAGAATAAGGTATGATGAAAGAAGCTGC
TGAATATTAATTCTTGGCTGCTTATTAGAGTAATGCAAATGCGAAAAAATGGGAGGGTAT
CGCTTAGTTATATAAAAAGGCAAAATGTTATGATAGTGCTGGCTATTGCTTTGGGAGAGT
TCTTAAAAGCGACACATTAAATACATCTCTTTGGTGTGAGAGAGCTAAGTGCTACGAACA
AACAGGTGAACTTAAAAAAGCAATCAAATGCTTTGAAAGAGTTATTAAAATGGACGAAAA
GAATTTTGATGCTATAAAAAATTGTGCAAAAGTAAAGAGTTGTATTAAATTTGATTAAAA
TAATTTTAAAAAGAATTTAAAGCTATTTATATTTTTAATAATTTTGAAAAATATAAAGTT
TTATTATATTCTAACAGCTCTATTTGAAACTTGATAAGAGTGATGAAAGTATAAAGCTTC
TTAAAACAATGATTAAACCAAACGACATGAATAAGAATTATAATATTATCCACATGATAT
GTGAAATATTTAACAAAGTATATTTTAGCTTAGTTTTAATGCTTGCTTATTTTTTCTAAA
TAGATTTTTTAAGAAATAATAATATAAAGAATTGTGCGAATTTTTAGAGGAATACTGTGA
GATGAAAGATAAAAACGTTAGAGAAACCATTTTAGATGAACTTCCTTTAGCAATTTTAAT
ATTTTATGCTGTTTCACATGCAAAACTATAAAATAAGGAGGAAGTAAATATAATTTATAT
TAGAGTTGACAATTTTAACTTTCTAATAAAAATAGTGTGAATTAGGATTTAATTTAATTT
TAAGAAGAGAAATGGAAGAAAATGATGACTTTGTCTCTATCATGGAAGAACTTGCAGAAA
TGTATGAATCTTCAAAGGAAGAAGAAAAAGCTCTCTAAATTTACAAAAGATTAATATCAC
TGCCATTTTTGTAGATGAATTATCAATAAGTTTGGGAAAAATATGGAACATTATTACTTA
AACTTCACGAAAATGAAGAATCAATCAAAGAAATCGAAGAAATAATTTAAAAATTTCCAG
ATTCAATTGATTTAAGAACCGAGTTGTCTTCAGTATATTAGAGTCTTGGACGTAACTAGG
ATTCCTTAAAAATTCTTGAAAATTTACTAGTAAATTATTCAAATTTAAAAATAAAAATAT
AACTAAATATTTCTAAAGAGGGATGACATTGAAGAGAACGACTTCGAAACTAGGAAACAA
TCGGACGAAATCAATTTAGATATTAAAGAAGAGGACATTGACAGATATAGCTACACTGCA
TCATATTAAGATGAAAATAATGATGAAGATGAGTACATCTATTAAAACGATGATGATGAT
GAAGATGATGAAAACTATTAAGACCGAATTAAAGTTGACAAAAAAAATATTTTTGATAGA
TTTTATTTAGATAAATCAGATCAAAAGAAAGTAAGACATGCAAATTAAATAAAATAATTA
ATTAATTAATTAAAATTATATTTAGACTAAGAAAGAAATAGGTGTAGATAATGATGACAA
TGAAGATCAAGATGCAGGTGATGATGATAGCGATTTTAATTATGAAGAAGAGTAGCATAA
AAGAGTTAGTTAGAAAAAATAAGCTTCTAAAATTTCAGGATAATATGATTAAATGAGAGA
ATAAAATGAAATTAAGCCTATGAAAAAGAAAAAACTTAATAGCAGGGTAGAAAAAAAAAT
AAAAAATTAAATGGATGATGAGAAAGATGATGAAATCTTCTAAATAAATAAGTATTAACA
AAAAGATTTCTTTGAATAAACTTAAGCCAAAAAGAATGAATTAGCTTAACACTACTCAGT
CAAGAACATGTATCTTGAGTATAAAAAAGGATAAATAATTTTAGATACAACGAAGGAGAT
TTCGAAGCATAAACTTGATAAATAGTTCTAGACCTTAAAATAATCCCTTTAGCTTGAAAA
GGAATATAATGTAAATTTAAAAAAAATCAATACATTTAATCATTATATTAATAAATTAAT
AGAATTTAAAAAAATCTGTACTCAATCGTATTTTGATAGAAAGCTAAAAAAAAGGGTTCC
AGAGAAGACTAACAACTCCTAATAACCTAAAGACATTTGATAATCCAAATTAAACACTTC
TTATTAAAAAGAAAAGACAAATGGAGGAACAAGAAATATTAATGAAAAAAAAATTCAAAA
AATCAGAAGAACTGACAGCAAAATATTTATAGAATGTTGAAGTTCTTTCTTTAAAAGTTG
GTCATGAAGAATATATTTAATATTTAATTAAAATGCTTAAAGTGTTAGTGAAGTATGATT
GCTATGTAAAAATATCCAAAATTTGTTCATTGGCACATAAGTTGCATGTATGGAAAGATA
TAAGATTCTTTGGCTATCAAGAAACTGTTGCAAAATATGGGCTTCTAGCAACTCTTAAAT
TAGAGGTTCATTTTTATTTATTTTTTAATTTAATATTTTGTCATTGTTTTAAGTTTAATT
TTATTTATGAATATAAATAGAACTATGATAAAGCTTTTACATACATAAAGTTATTAATTA
ACAGAAATTCAGATAGACTGTATCTTTAAGTTATTTTATGTATTATAATGAGACATATAT
CTAATGTCAATATCTACAAAACATTTTTATCAAGAATGGTTAAAAAATCTGATGATTCAC
CTAAATTTTTACCAATTGTTGCATGTGGTTTTTTAGAAACAGGAAACTTTGATTTAGCAA
CTGATGTTCTTCATACAATACTTAAAAATGATAAAGCAAATTCATTATGTAATTTATCTT
TAAGTGTATGCTATGCTTAACTAACAACAGCAAGAACAACTTATGAAAAAGAGCAAATGG
CTGCTAAAGCTGTTCATTACATGTAAGCCTACTAATAAACTAGAGGATTGACTAGATAAA
TGGAAATATATTATAATTTAGGTAGATTCTTCATTCATCTTAGCATGAATGAAAAAGCTA
TTGAAAACTTCGAAAATTGTATTTAACTTTTTTCAAGTAAAAATTTGAAAGGAAGCTACA
CATTAAACCCAAAATCTAAAGAAACAGACGAAAAAATACTTTAAAAGGCAATTTATAACT
TAATTTTGCTTCATAAAAATTTAGGTAATTACCAAATAGCCCAATCTTTATTAAGATAAT
ACAATACTCTAAGTTGA