Identifiers and Description

Gene Model Identifier

TTHERM_00683400

Standard Name

TFC4 (TFIIIC subunit 4)

Aliases

PreTt16177 | 103.m00168 | 3734.m00080

Description

TFC4 tetratricopeptide repeat protein; RNA polymerase III transcription initiation factor complex (TFIIIC) subunit TFC4

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF04702 ) Vicilin N terminal region
  • ( PF00806 ) Pumilio-family RNA binding repeat
  • ( PF06784 ) Uncharacterised protein family (UPF0240)
  • ( TIGR02521 ) type IV pilus biogenesis/stability protein
  • ( TIGR02552 ) type III secretion low calcium

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00683400

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17828.19.997093137033517e-262hypothetical protein (1001 aa)
OxytrichaContig9885.0.g741.999598840915195e-17TPR repeat
DictyBaseDDB_G02783211.000361553249356e-16gtf3C3 on chromosome: 3 positi
on 689224 to 692344
SGDYGR047C9.001232279470736e-16TFC4 One of six subunits of th
e RNA polymerase III transcrip
tion initiation factor complex
(TFIIIC); part of the TauA do
main of TFIIIC that binds BoxA
DNA promoter sites of tRNA an
d similar genes; has TPR motif
s; human homolog is TFIIIC-102
WormBaseWBGene000010250.000030009396760408108locus:dnj-7 status:Partially
_confirmed UniProt:P91189
protein_id:CCD68078.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00683400(coding)
ATGAGTAATAATACCAAACGTGAATATTAAGATGATGATGACGAGGAACATGATAGCGAT
TTAATGAGCGACTTCTCAGATGAAGAAAAGCGTCACAAAGACTTAAAGAGCTAATTTAAA
GGCTAAAGGCAATAAAAGATCCCTCAATAAATTTCATAACTCATTAGTGATGCTAATTCA
AAATATGTCTTTTAAAATCAAATAGACGAAGCCATAGAAATAGCAAAAGAAATTATTAGA
CAATACCCTAGTTTTACAGATTCTTATGATTTGCTTGGAAACATTTTTGAAGAATAAGGT
ATGATGAAAGAAGCTGCTGAATATTAATTCTTGGCTGCTTATTAGAGTAATGCAAATGCG
AAAAAATGGGAGGGTATCGCTTAGTTATATAAAAAGGCAAAATGTTATGATAGTGCTGGC
TATTGCTTTGGGAGAGTTCTTAAAAGCGACACATTAAATACATCTCTTTGGTGTGAGAGA
GCTAAGTGCTACGAACAAACAGGTGAACTTAAAAAAGCAATCAAATGCTTTGAAAGAGTT
ATTAAAATGGACGAAAAGAATTTTGATGCTATAAAAAATTGTGCAAAACTCTATTTGAAA
CTTGATAAGAGTGATGAAAGTATAAAGCTTCTTAAAACAATGATTAAACCAAACGACATG
AATAAGAATTATAATATTATCCACATGATATGTGAAATATTTAACAAAAAATAATAATAT
AAAGAATTGTGCGAATTTTTAGAGGAATACTGTGAGATGAAAGATAAAAACGTTAGAGAA
ACCATTTTAGATGAACTTCCTTTAGCAATTTTAATATTTTATGCTGTTTCACATGCAAAA
CTATAAAATAAGGAGGAATGTGAATTAGGATTTAATTTAATTTTAAGAAGAGAAATGGAA
GAAAATGATGACTTTGTCTCTATCATGGAAGAACTTGCAGAAATGTATGAATCTTCAAAG
GAAGAAGAAAAAGCTCTCTAAATTTACAAAAGATTAATATCACTGCCATTTTTGTAGATG
AATTATCAATAAGTTTGGGAAAAATATGGAACATTATTACTTAAACTTCACGAAAATGAA
GAATCAATCAAAGAAATCGAAGAAATAATTTAAAAATTTCCAGATTCAATTGATTTAAGA
ACCGAGTTGTCTTCAGTATATTAGAGTCTTGGACGTAACTAGGATTCCTTAAAAATTCTT
GAAAATTTACTAAGGGATGACATTGAAGAGAACGACTTCGAAACTAGGAAACAATCGGAC
GAAATCAATTTAGATATTAAAGAAGAGGACATTGACAGATATAGCTACACTGCATCATAT
TAAGATGAAAATAATGATGAAGATGAGTACATCTATTAAAACGATGATGATGATGAAGAT
GATGAAAACTATTAAGACCGAATTAAAGTTGACAAAAAAAATATTTTTGATAGATTTTAT
TTAGATAAATCAGATCAAAAGAAAACTAAGAAAGAAATAGGTGTAGATAATGATGACAAT
GAAGATCAAGATGCAGGTGATGATGATAGCGATTTTAATTATGAAGAAGAGTAGCATAAA
AGAGTTAGTTAGAAAAAATAAGCTTCTAAAATTTCAGGATAATATGATTAAATGAGAGAA
TAAAATGAAATTAAGCCTATGAAAAAGAAAAAACTTAATAGCAGGGTAGAAAAAAAAATA
AAAAATTAAATGGATGATGAGAAAGATGATGAAATCTTCTAAATAAATAAGTATTAACAA
AAAGATTTCTTTGAATAAACTTAAGCCAAAAAGAATGAATTAGCTTAACACTACTCAGTC
AAGAACATGTATCTTGAGTATAAAAAAGGATAAATAATTTTAGATACAACGAAGGAGATT
TCGAAGCATAAACTTGATAAATAGTTCTAGACCTTAAAATAATCCCTTTAGCTTGAAAAG
GAATATAATAATTTAAAAAAATCTGTACTCAATCGTATTTTGATAGAAAGCTAAAAAAAA
GGGTTCCAGAGAAGACTAACAACTCCTAATAACCTAAAGACATTTGATAATCCAAATTAA
ACACTTCTTATTAAAAAGAAAAGACAAATGGAGGAACAAGAAATATTAATGAAAAAAAAA
TTCAAAAAATCAGAAGAACTGACAGCAAAATATTTATAGAATGTTGAAGTTCTTTCTTTA
AAAGTTGGTCATGAAGAATATATTTAATATTTAATTAAAATGCTTAAAGTGTTAGTGAAG
TATGATTGCTATGTAAAAATATCCAAAATTTGTTCATTGGCACATAAGTTGCATGTATGG
AAAGATATAAGATTCTTTGGCTATCAAGAAACTGTTGCAAAATATGGGCTTCTAGCAACT
CTTAAATTAGAGAACTATGATAAAGCTTTTACATACATAAAGTTATTAATTAACAGAAAT
TCAGATAGACTGTATCTTTAAGTTATTTTATGTATTATAATGAGACATATATCTAATGTC
AATATCTACAAAACATTTTTATCAAGAATGGTTAAAAAATCTGATGATTCACCTAAATTT
TTACCAATTGTTGCATGTGGTTTTTTAGAAACAGGAAACTTTGATTTAGCAACTGATGTT
CTTCATACAATACTTAAAAATGATAAAGCAAATTCATTATGTAATTTATCTTTAAGTGTA
TGCTATGCTTAACTAACAACAGCAAGAACAACTTATGAAAAAGAGCAAATGGCTGCTAAA
GCTGTTCATTACATGTAAGCCTACTAATAAACTAGAGGATTGACTAGATAAATGGAAATA
TATTATAATTTAGGTAGATTCTTCATTCATCTTAGCATGAATGAAAAAGCTATTGAAAAC
TTCGAAAATTGTATTTAACTTTTTTCAAGTAAAAATTTGAAAGGAAGCTACACATTAAAC
CCAAAATCTAAAGAAACAGACGAAAAAATACTTTAAAAGGCAATTTATAACTTAATTTTG
CTTCATAAAAATTTAGGTAATTACCAAATAGCCCAATCTTTATTAAGATAATACAATACT
CTAAGTTGA


>TTHERM_00683400(protein)
MSNNTKREYQDDDDEEHDSDLMSDFSDEEKRHKDLKSQFKGQRQQKIPQQISQLISDANS
KYVFQNQIDEAIEIAKEIIRQYPSFTDSYDLLGNIFEEQGMMKEAAEYQFLAAYQSNANA
KKWEGIAQLYKKAKCYDSAGYCFGRVLKSDTLNTSLWCERAKCYEQTGELKKAIKCFERV
IKMDEKNFDAIKNCAKLYLKLDKSDESIKLLKTMIKPNDMNKNYNIIHMICEIFNKKQQY
KELCEFLEEYCEMKDKNVRETILDELPLAILIFYAVSHAKLQNKEECELGFNLILRREME
ENDDFVSIMEELAEMYESSKEEEKALQIYKRLISLPFLQMNYQQVWEKYGTLLLKLHENE
ESIKEIEEIIQKFPDSIDLRTELSSVYQSLGRNQDSLKILENLLRDDIEENDFETRKQSD
EINLDIKEEDIDRYSYTASYQDENNDEDEYIYQNDDDDEDDENYQDRIKVDKKNIFDRFY
LDKSDQKKTKKEIGVDNDDNEDQDAGDDDSDFNYEEEQHKRVSQKKQASKISGQYDQMRE
QNEIKPMKKKKLNSRVEKKIKNQMDDEKDDEIFQINKYQQKDFFEQTQAKKNELAQHYSV
KNMYLEYKKGQIILDTTKEISKHKLDKQFQTLKQSLQLEKEYNNLKKSVLNRILIESQKK
GFQRRLTTPNNLKTFDNPNQTLLIKKKRQMEEQEILMKKKFKKSEELTAKYLQNVEVLSL
KVGHEEYIQYLIKMLKVLVKYDCYVKISKICSLAHKLHVWKDIRFFGYQETVAKYGLLAT
LKLENYDKAFTYIKLLINRNSDRLYLQVILCIIMRHISNVNIYKTFLSRMVKKSDDSPKF
LPIVACGFLETGNFDLATDVLHTILKNDKANSLCNLSLSVCYAQLTTARTTYEKEQMAAK
AVHYMQAYQQTRGLTRQMEIYYNLGRFFIHLSMNEKAIENFENCIQLFSSKNLKGSYTLN
PKSKETDEKILQKAIYNLILLHKNLGNYQIAQSLLRQYNTLS


>TTHERM_00683400(gene)
ATGAGTAATAATACCAAACGTGAATATTAAGATGATGATGACGAGGAACATGATAGCGAT
TTAATGAGGTTATTTATCTTTAGCCATTTACTTTTCATTCAAATAAATTATATGTGATTC
ATTTTAAAATATTTAATTATCTACAGCGACTTCTCAGATGAAGAAAAGCGTCACAAAGAC
TTAAAGAGCTAATTTAAAGGCTAAAGGCAATAAAAGATCCCTCAATAAATTTCATAACTC
ATTAGTGATGCTAATTCAAAATATGTCTTTTAAAATCAAATAGACGAAGTATGAGCTAAT
TTAATATAAGTGTTTTACATTTATCAACAAGATGAATAAATAAAGCATCATCAAAATTTA
AACCCTAAATTTAGAATTTTTCATTTTATTTACTTAATTTATAATATTTTAAACATCATG
TATAAATTTCTAGGCCATAGAAATAGCAAAAGAAATTATTAGACAATACCCTAGTTTTAC
AGATTCTTATGATTTGCTTGGAAACATTTTTGAAGAATAAGGTATGATGAAAGAAGCTGC
TGAATATTAATTCTTGGCTGCTTATTAGAGTAATGCAAATGCGAAAAAATGGGAGGGTAT
CGCTTAGTTATATAAAAAGGCAAAATGTTATGATAGTGCTGGCTATTGCTTTGGGAGAGT
TCTTAAAAGCGACACATTAAATACATCTCTTTGGTGTGAGAGAGCTAAGTGCTACGAACA
AACAGGTGAACTTAAAAAAGCAATCAAATGCTTTGAAAGAGTTATTAAAATGGACGAAAA
GAATTTTGATGCTATAAAAAATTGTGCAAAAGTAAAGAGTTGTATTAAATTTGATTAAAA
TAATTTTAAAAAGAATTTAAAGCTATTTATATTTTTAATAATTTTGAAAAATATAAAGTT
TTATTATATTCTAACAGCTCTATTTGAAACTTGATAAGAGTGATGAAAGTATAAAGCTTC
TTAAAACAATGATTAAACCAAACGACATGAATAAGAATTATAATATTATCCACATGATAT
GTGAAATATTTAACAAAGTATATTTTAGCTTAGTTTTAATGCTTGCTTATTTTTTCTAAA
TAGATTTTTTAAGAAATAATAATATAAAGAATTGTGCGAATTTTTAGAGGAATACTGTGA
GATGAAAGATAAAAACGTTAGAGAAACCATTTTAGATGAACTTCCTTTAGCAATTTTAAT
ATTTTATGCTGTTTCACATGCAAAACTATAAAATAAGGAGGAAGTAAATATAATTTATAT
TAGAGTTGACAATTTTAACTTTCTAATAAAAATAGTGTGAATTAGGATTTAATTTAATTT
TAAGAAGAGAAATGGAAGAAAATGATGACTTTGTCTCTATCATGGAAGAACTTGCAGAAA
TGTATGAATCTTCAAAGGAAGAAGAAAAAGCTCTCTAAATTTACAAAAGATTAATATCAC
TGCCATTTTTGTAGATGAATTATCAATAAGTTTGGGAAAAATATGGAACATTATTACTTA
AACTTCACGAAAATGAAGAATCAATCAAAGAAATCGAAGAAATAATTTAAAAATTTCCAG
ATTCAATTGATTTAAGAACCGAGTTGTCTTCAGTATATTAGAGTCTTGGACGTAACTAGG
ATTCCTTAAAAATTCTTGAAAATTTACTAGTAAATTATTCAAATTTAAAAATAAAAATAT
AACTAAATATTTCTAAAGAGGGATGACATTGAAGAGAACGACTTCGAAACTAGGAAACAA
TCGGACGAAATCAATTTAGATATTAAAGAAGAGGACATTGACAGATATAGCTACACTGCA
TCATATTAAGATGAAAATAATGATGAAGATGAGTACATCTATTAAAACGATGATGATGAT
GAAGATGATGAAAACTATTAAGACCGAATTAAAGTTGACAAAAAAAATATTTTTGATAGA
TTTTATTTAGATAAATCAGATCAAAAGAAAGTAAGACATGCAAATTAAATAAAATAATTA
ATTAATTAATTAAAATTATATTTAGACTAAGAAAGAAATAGGTGTAGATAATGATGACAA
TGAAGATCAAGATGCAGGTGATGATGATAGCGATTTTAATTATGAAGAAGAGTAGCATAA
AAGAGTTAGTTAGAAAAAATAAGCTTCTAAAATTTCAGGATAATATGATTAAATGAGAGA
ATAAAATGAAATTAAGCCTATGAAAAAGAAAAAACTTAATAGCAGGGTAGAAAAAAAAAT
AAAAAATTAAATGGATGATGAGAAAGATGATGAAATCTTCTAAATAAATAAGTATTAACA
AAAAGATTTCTTTGAATAAACTTAAGCCAAAAAGAATGAATTAGCTTAACACTACTCAGT
CAAGAACATGTATCTTGAGTATAAAAAAGGATAAATAATTTTAGATACAACGAAGGAGAT
TTCGAAGCATAAACTTGATAAATAGTTCTAGACCTTAAAATAATCCCTTTAGCTTGAAAA
GGAATATAATGTAAATTTAAAAAAAATCAATACATTTAATCATTATATTAATAAATTAAT
AGAATTTAAAAAAATCTGTACTCAATCGTATTTTGATAGAAAGCTAAAAAAAAGGGTTCC
AGAGAAGACTAACAACTCCTAATAACCTAAAGACATTTGATAATCCAAATTAAACACTTC
TTATTAAAAAGAAAAGACAAATGGAGGAACAAGAAATATTAATGAAAAAAAAATTCAAAA
AATCAGAAGAACTGACAGCAAAATATTTATAGAATGTTGAAGTTCTTTCTTTAAAAGTTG
GTCATGAAGAATATATTTAATATTTAATTAAAATGCTTAAAGTGTTAGTGAAGTATGATT
GCTATGTAAAAATATCCAAAATTTGTTCATTGGCACATAAGTTGCATGTATGGAAAGATA
TAAGATTCTTTGGCTATCAAGAAACTGTTGCAAAATATGGGCTTCTAGCAACTCTTAAAT
TAGAGGTTCATTTTTATTTATTTTTTAATTTAATATTTTGTCATTGTTTTAAGTTTAATT
TTATTTATGAATATAAATAGAACTATGATAAAGCTTTTACATACATAAAGTTATTAATTA
ACAGAAATTCAGATAGACTGTATCTTTAAGTTATTTTATGTATTATAATGAGACATATAT
CTAATGTCAATATCTACAAAACATTTTTATCAAGAATGGTTAAAAAATCTGATGATTCAC
CTAAATTTTTACCAATTGTTGCATGTGGTTTTTTAGAAACAGGAAACTTTGATTTAGCAA
CTGATGTTCTTCATACAATACTTAAAAATGATAAAGCAAATTCATTATGTAATTTATCTT
TAAGTGTATGCTATGCTTAACTAACAACAGCAAGAACAACTTATGAAAAAGAGCAAATGG
CTGCTAAAGCTGTTCATTACATGTAAGCCTACTAATAAACTAGAGGATTGACTAGATAAA
TGGAAATATATTATAATTTAGGTAGATTCTTCATTCATCTTAGCATGAATGAAAAAGCTA
TTGAAAACTTCGAAAATTGTATTTAACTTTTTTCAAGTAAAAATTTGAAAGGAAGCTACA
CATTAAACCCAAAATCTAAAGAAACAGACGAAAAAATACTTTAAAAGGCAATTTATAACT
TAATTTTGCTTCATAAAAATTTAGGTAATTACCAAATAGCCCAATCTTTATTAAGATAAT
ACAATACTCTAAGTTGA