Identifiers and Description

Gene Model Identifier

TTHERM_00152050

Standard Name

TFB2 (RNA polymerase II transcription factor B subunit 2)

Aliases

PreTt20863 | 12.m00537 | 3700.m00256

Description

general transcription factor IIH subunit 2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00152050

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05153.19.997093137033517e-262transcription factor ssl1 fami
ly protein (375 aa)
DictyBaseDDB_G02723624.998233068678632e-48gtf2h2 on chromosome: 2 positi
on 1296713 to 1298183
OxytrichaContig14857.0.g419.997441244797434e-45Ssl1-like
WormBaseWBGene000118145.000680012816624e-42General transcription factor I
IH subunit 2 status:Confirme
d UniProt:P34567 protein_i
d:CAA83139.3
SGDYLR005W1.999683289470905e-41SSL1 Component of the core for
m of RNA polymerase transcript
ion factor TFIIH, which has bo
th protein kinase and DNA-depe
ndent ATPase/helicase activiti
es and is essential for transc
ription and nucleotide excisio
n repair; interacts with Tfb4p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00152050(coding)
ATGGATATTGAAGAAGCAGATAGAAGATCAATTATTGATTTCGTAGAATAAAAACTAAAT
ATTAAAGAAGAAAATCCTTTAATACAAACAAAGAAAATCATCGATAAAGGATATACCTCT
ACAACAAAAAAGAGTCTCCTAAGATTTGTATATATTATAGTTGATACAACCTAATCTTCT
ACAAGAGTAGATTTCAAGCCTTCGAGAATAGGACTAACGTAAATCTACTTAAAGAACTTC
ATAAAAAACTTTTTTGATTCTAATCCTTTGAGTGTATTATCTATTGGTAAAACATAAAAT
GGCTAGTGTATAACTCTTTAAGAATTTACATCTAGTATATCTCTTTTAGATAAAACAATC
GAAAAACTTGTAGTTGATGAAAAGGAGGATTTTTCTCTTTTTGAATGTTTAAATGAAACT
TTTAATATTTTTGCTGAAGCACCTCCATATGCTTTCAGAGAAGTAGTTCTAATTTAGTCA
ACACCTTCAACAAAAGATAAAGGTGATATAAATGAATAAATAAATAAAGCCAAATAATGC
AAAATAACTTTTAATATTATATCACTTAATGCAAAAACATTCATATTTTAGAAATTGACA
AAAGAGACATAAGGTAAATATGACACAGCTTTACATGAAAAAGATTATGAAAATTTACTT
AACAGCTATTGTGAACCTCCATAATAAATATTAAATAAAACTGAAAAAACTCTTATACAA
GTTGGTTTCCCTAATAAAAAATATTCTAAAATTTCTGTATTATGTGCTTGCCATATGGAG
TTAAAAACTAACTTTTACATTTGCCCTTAATGCAAAAGTAAAAACTGTGAAGTTCCTTCA
AAATGTTCAGGATGCCAATTAAATTTAATTCTTCCTTTGCATATCACAAAGAGCTATCAT
TTTAGTTAAAATTTAAAAGAATTCGAATTGTTAGGACAAGAAAAATCTAATAATAGTATG
GAAACCGAGTAAGATAAAACATAAAATATCCTTTGTAATGGATGCTCTGAAGATATTAAA
GAAGATTACTTCTCAAAATGTTAAAATTGTAAATCAATATTCTGCTTGGAATGTGATATT
TTAATACACAAGCAAAAGCTAAATTGTCCTAAATGTTGA


>TTHERM_00152050(protein)
MDIEEADRRSIIDFVEQKLNIKEENPLIQTKKIIDKGYTSTTKKSLLRFVYIIVDTTQSS
TRVDFKPSRIGLTQIYLKNFIKNFFDSNPLSVLSIGKTQNGQCITLQEFTSSISLLDKTI
EKLVVDEKEDFSLFECLNETFNIFAEAPPYAFREVVLIQSTPSTKDKGDINEQINKAKQC
KITFNIISLNAKTFIFQKLTKETQGKYDTALHEKDYENLLNSYCEPPQQILNKTEKTLIQ
VGFPNKKYSKISVLCACHMELKTNFYICPQCKSKNCEVPSKCSGCQLNLILPLHITKSYH
FSQNLKEFELLGQEKSNNSMETEQDKTQNILCNGCSEDIKEDYFSKCQNCKSIFCLECDI
LIHKQKLNCPKC


>TTHERM_00152050(gene)
ATGGATATTGAAGAAGCAGATAGAAGATCAATTATTGATTTCGTAGAATAAAAACTAAAT
ATTAAAGAAGAAAATCCTTTAATACAAACAAAGAAAATCATCGATAAAGGATATACCTCT
ACAACAAAAAAGAGTCTCCTAAGATTTGTATATATTATAGTTGATACAACCTAATCTTCT
ACAAGAGTAGATTTCAAGCCTTCGAGAATAGGACTAACGTAAATCTACTTAAAGGTAATA
ATATTGCATTCAAAATTTTTAATTTATAAAAAATTAATATTATTTTTAATATTAATTAGA
ACTTCATAAAAAACTTTTTTGATTCTAATCCTTTGAGTGTATTATCTATTGGTAAAACAT
AAAATGGCTAGTGTATAACTCTTTAAGAATTTACATCTAGTATATCTCTTTTAGATAAAA
CAATCGAAAAACTTGTAGTTGATGAAAAGGAGGATTTTTCTCTTTTTGAATGTTTAAATG
TAAATTTATAAATTTCTTTTGAATGTTTGTGAATAAAATATTTTTTAAGACCAAATCTTT
ATCTAAAAAACATTTAAAATAAAGGAAACTTTTAATATTTTTGCTGAAGCACCTCCATAT
GCTTTCAGAGAAGTAGTTCTAATTTAGTCAACACCTTCAACAAAAGATAAAGGTGATATA
AATGAATAAATAAATAAAGCCAAATAATGCAAAATAACTTTTAATATTATATCACTTAAT
GCAAAAACATTCATATTTTAGGTAAATAGATTTTAAATTTATACATTGCACAAACCATGC
AAAACTCTATATTTAATAGAAATTGACAAAAGAGACATAAGGTAAATATGACACAGCTTT
ACATGAAAAAGATTATGAAAATTTACTTAACAGCTATTGTGAACCTCCATAATAAATATT
AAATAAAACTGAAAAAACTCTTATACAAGTTGGTTTCCCTAATAAAAAATATTCTAAAAT
TTCTGTATTATGTGCTTGCCATATGGAGTTAAAAACTAACTTTTACATTTGCCCTTAATG
CAAAAGTAAAAACTGTGAAGTTCCTTCAAAATGTTCAGTAACTAATTTTTTAGAATTTTT
AAAAATTTACAAGTTTTTATTAAATTTACTAATAAGGGATGCCAATTAAATTTAATTCTT
CCTTTGCATATCACAAAGAGCTATCATTTTAGTTAAAATTTAAAAGAATTCGAATTGTTA
GGACAAGAAAAATCTAATAATAGTATGGAAACCGAGTAAGATAAAACATAAAATATCCTT
TGTAATGGATGCTCTGAAGATATTAAAGAAGATTACTTCTCAAAATGTTAAAATTGTAAA
TCAATATTCTGCTTGTAAATTAATTGTTTTATTCACACAAGCAACTTTTTAACAATTTTT
TAACTAAATTTTATAGGGAATGTGATATTTTAATACACAAGCAAAAGCTAAATTGTCCTA
AATGTTGA