Identifiers and Description

Gene Model Identifier

TTHERM_00678260

Standard Name

TFA (Tetrahymena homolog of the liver F-Antigen)

Aliases

PreTt07590 | 102.m00110 | 3730.m00037

Description

Homolog of vertebrate liver F-antigen; constituent of the intracellular membrane network; associated with membranes of the Golgi apparatus and transport vesicles

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00678260

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16390.19.997093137033517e-2624-hydroxyphenylpyruvate dioxyg
enase (434 aa)
OxytrichaContig5080.0.g132.000147820282363e-173Glyoxalase/Bleomycin resistanc
e protein/Dioxygenase superfam
ily
WormBaseWBGene000019939.996149531968772e-161locus:hpd-1 4-hydroxyphenylp
yruvate dioxygenase status:C
onfirmed UniProt:Q22633 pr
otein_id:CAA90315.1
DictyBaseDDB_G02775112.998986826334339e-156hpd on chromosome: 2 position
8032660 to 8033990
Stentor CoeruleusSteCoe_222856.542840619051457e-69

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:1469718: Hummel R, Nørgaard P, Andreasen PH, Neve S, Skjødt K, Tornehave D, Kristiansen K (1992) Tetrahymena gene encodes a protein that is homologous with the liver-specific F-antigen and associated with membranes of the Golgi apparatus and transport vesicles. Journal of molecular biology 228(3):850-61

Sequences

>TTHERM_00678260(coding)
ATGAGTGAAAATAAAGATCACGTTGTTGTTGGATACACTGAAAAGCCTGTTGGTGAAAGA
CCTACTGGTGGTAAGTTCTTAGGTTATGATCACTTACATTTCTGGGTTGGTAATGCCAAG
CAAGCTGCAGGATGGTACACTTCTCGTTTTGGTTTCGAATACTATGCTTACAAGGGTTTG
GAAACTGGTAGCAGAGAAGTTGCAACTCACGTTGTCCGTAATAAATAAGGTGTCACTTTA
GCCTTCAGTACTCCCTATGGAAACGACAAGGACAACTAAAGGGAAATGAACTAACATTAA
AGTTTACACGGTGATGGTGTTAAGGATGTCGCTTTTGCTGTTGAAGACTGTCACTCTATT
TACAACAAGGCTATCTAAAGAGGTGCCAAGTGTGCTTATCCTCCTCAAGATTTGAAGGAC
GAACATGGTAGTGTCACTATTGCTGCAGTCCACACTTATGGTGAAGTTATTCACACATTT
ATCCAAAGAAATGACTATAAAGGTTTCTTCATGCCTGGATTTGTTGCTCACCCCTTAAAG
GACCCCCTTAACAATGTTCTTCCTGACATCAGCTACAACTATGTAGATCATATTGTTGGT
AACCAACCTGATAACATGATGACCTCTGCTGCTGACTGGTATGAAAAGACTTTGGACTTC
CACAGATTCTGGTCTGTTGATGACAGCATGATCCACACTGAATTCTCTTCCTTAAGATCT
ATTGTCATGACTGACTACGATTAAAAGATTAAAATGCCCATTAACGAACCTGCTGATGGA
AAGAGAAAATCATAAATCTAAGAATATATTGATTTCTATGCTGGCCCTGGTGTATAACAC
ATTGCCTTGAATACAAGTGATGTAATCAACACTGTCGAAGGTCTTAGAGCTAGAGGTGTT
GAATTTTTATCTATTCCTACTTCCTATTATGATAATCTCAGAAAGGCTCTTACTGCATAG
ACTTCTATCACTGTTAAGGAAGATCTTGATGTCTTACAAAAGAACCATATTTTAGTTGAT
TATGATGAAAAGGGTTACCTCTTATAAATCTTCACCAAGCCTGTTGAAGATAGACCTACT
CTCTTCTACGAAATCATTCAAAGAAATAACCATTAAGGATTCGGTGCTGGTAACTTCAAG
TCCTTGTTTGTCTCTTTGGAACTTGAATAAGAAAAGAGAGGAAACCTTACTGAAATTGTC
AAGAACATCTATTGA


>TTHERM_00678260(protein)
MSENKDHVVVGYTEKPVGERPTGGKFLGYDHLHFWVGNAKQAAGWYTSRFGFEYYAYKGL
ETGSREVATHVVRNKQGVTLAFSTPYGNDKDNQREMNQHQSLHGDGVKDVAFAVEDCHSI
YNKAIQRGAKCAYPPQDLKDEHGSVTIAAVHTYGEVIHTFIQRNDYKGFFMPGFVAHPLK
DPLNNVLPDISYNYVDHIVGNQPDNMMTSAADWYEKTLDFHRFWSVDDSMIHTEFSSLRS
IVMTDYDQKIKMPINEPADGKRKSQIQEYIDFYAGPGVQHIALNTSDVINTVEGLRARGV
EFLSIPTSYYDNLRKALTAQTSITVKEDLDVLQKNHILVDYDEKGYLLQIFTKPVEDRPT
LFYEIIQRNNHQGFGAGNFKSLFVSLELEQEKRGNLTEIVKNIY


>TTHERM_00678260(gene)
ATGAGTGAAAATAAAGATCACGTTGTTGTTGGATACACTGAAAAGCCTGTTGGTGAAAGA
CCTACTGGTGGTAAGTTCTTAGGTTATGATCACTTACATTTCTGGGTTGGTAATGCCAAG
CAAGCTGCAGGATGGTACACTTCTCGTTTTGGTTTCGAATACTATGCTTACAAGGGTTTG
GAAACTGGTAGCAGAGAAGTTGCAACTCACGTTGTCCGTAATAAATAAGGTGTCACTTTA
GCCTTCAGTACTCCCTATGGAAACGACAAGGACAACTAAAGGGAAATGAACTAACATTAA
AGTTTACACGGTGATGGTGTTAAGGATGTCGCTTTTGCTGTAATTTTAATTATCTAAATT
CTTTATCATAAATTAAAAAAGAAAAGCTAATGAAAAAATGATAATTTAACTTATATTTTA
TTAATAAGGTTGAAGACTGTCACTCTATTTACAACAAGGCTATCTAAAGAGGTGCCAAGT
GTGCTTATCCTCCTCAAGATTTGAAGGACGAACATGGTAGTGTCACTATTGCTGCAGTCC
ACACTTATGGTGAAGTTATTCACACATTTATCCAAAGAAATGACTATAAAGGTTTCTTCA
TGCCTGGATTTGTTGCTCACCCCTTAAAGGACCCCCTTAACAATGTTCTTCCTGACATCA
GCTACAACTATGTAGATCATATTGTTGGTAACCAACCTGTAAGATTAAATTTAAAAAAAA
TATTTTGAAGGAATAATTAATTCAGTAAAAAAAATGTTTAAATGGCTATCTTATAAGTAA
TCTACTACAAAACTCCCATCAAAGATGAAGAAATTTATTATTAAAGACAAATAGAACTTA
ATAAATACTTAAAAATAGCAAATAAAATCAATTTTAGAAATATTCTAAACATTTCTCTAG
AAAAAGTAAAAAAGAATAGCCATAAATTCAAGCGAGTAGTTAGTCATTCATAAATTTGAT
TAAAATACAAAAAGAGCAAATTTATAATTAAATAAATTAATTAATTAAATAGATGTATGT
ATTTAATAAAATGCTCATATTTTGTTTATTATAAATAGGATAACATGATGACCTCTGCTG
CTGACTGGTATGAAAAGACTTTGGACTTCCACAGATTCTGGTCTGTTGATGACAGCATGA
TCCACACTGAATTCTCTTCCTTAAGATCTATTGTCATGACTGACTACGATTAAAAGATTA
AAATGCCCATTAACGAACCTGCTGATGGAAAGAGAAAATCATAAATCTAAGAATATATTG
ATTTCTATGCTGGCCCTGGTGTATAACACATTGCCTTGAATACAAGTGATGTAATCAACA
CTGTCGAAGGTCTTAGAGCTAGAGGTGTTGAATTTTTATCTATTCCTACTTCCTATTATG
ATAATCTCAGAAAGGCTCTTACTGCATAGACTTCTATCACTGTTAAGGAAGATCTTGATG
TCTTACAAAAGAACCATATTTTAGTTGATTATGATGAAAAGGGTTACCTCTTATAAATCT
TCACCAAGCCTGTTGAAGATAGGTAAAAGATTTACTTCATTTATTATTTAGTTTTTAATT
TAGATTAGACTTTGAAATTCATCAAACTTTTCTGATGAATCTTCGAACAATTTTGATCAA
ACTAAACTTTTTCTAATATTTTTAATTAATTAATAAAAATAGACCTACTCTCTTCTACGA
AATCATTCAAAGAAATAACCATTAAGGATTCGGTGCTGGTAACTTCAAGTCCTTGTTTGT
CTCTTTGGAACTTGAATAAGAAAAGAGAGGAAACCTTACTGAAATTGTCAAGAACATCTA
TTGA