Identifiers and Description

Gene Model Identifier

TTHERM_00112560

Standard Name

TERT1 (telomerase reverse transcriptase (TERT); unique gene in Tetrahymena)

Aliases

PreTt27070 | 8.m00330 | 3812.m02367

Description

telomerase holoenzyme subunit of 133 kDa (p133) containing the enzyme active site; essential gene; knockdown induces telomere shortening

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.2%

TetraMine Data

TTHERM_00112560

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
OxytrichaContig1013.1.g896.997046864049712e-88Telomerase ribonucleoprotein c
omplex - RNA binding domain
Stentor CoeruleusSteCoe_241825.74952226429356e-19
SGDYLR318W0.000008000552149328928EST2 Reverse transcriptase sub
unit of the telomerase holoenz
yme, essential for telomerase
core catalytic activity, invol
ved in other aspects of telome
rase assembly and function; mu
tations in human homolog are a
ssociated with aplastic anemia
DictyBaseDDB_G02939180.0000899730839127287tert on chromosome: 6 position
3475961 to 3479914

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00112560(coding)
ATGTAGAAAATTAACAATATTAATAATAATAAATAAATGTTAACCAGAAAAGAAGATTTG
CTAACTGTTTTAAAATAAATCTCTGCTCTAAAGTATGTTTCAAATTTGTATGAATTTTTG
TTAGCAACAGAAAAAATAGTACAAACAAGTGAGCTTGATACATAGTTTTAAGAGTTTTTA
ACAACAACTATAATTGCGAGCGAGTAAAATTTAGTTGAAAACTACAAGCAAAAATACAAC
CAACCTAACTTCAGTTAACTGACCATTAAATAAGTTATCGATGATAGCATTATTTTGCTA
GGAAACAAATAAAATTATGTACAGTAAATAGGGACAACAACTATTGGCTTTTATGTTGAA
TATGAAAATATTAATCTTTCAAGACAAACTCTCTATTCTTCAAATTTTAGAAATCTTTTA
AATATCTTCGGAGAAGAAGATTTTAAATATTTTTTAATAGATTTTTTGGTATTCACTAAA
GTAGAATAAAATGGCTATTTACAGGTAGCAGGAGTCTGTTTGAATTAATATTTTTCTGTT
TAAGTTAAATAAAAAAAATGGTATAAAAATAACTTTAATATGAATGGTAAAGCTACAAGT
AATAATAATCAAAATAATGCTAATCTTAGCAATGAGAAAAAGTAAGAAAATCAGTACATT
TATCCTGAAATTTAGAGATCATAAATATTCTATTGCAATCATATGGGAAGAGAACCAGGA
GTTTTTAAATCAAGTTTTTTCAACTACTCAGAGATAAAAAAGGGTTTTTAATTCAAAGTA
ATTTAAGAAAAACTGCAAGGAAGATAATTTATTAATTCAGATAAAATAAAACCTGACCAC
CCTCAAACTATTATTAAAAAAACTTTGTTGAAGGAATATCAAAGCAAAAATTTTTCGTGC
TAAGAAGAAAGAGATTTATTTTTAGAATTTACAGAAAAAATTGTGCAGAACTTTCATAAT
ATCAACTTCAATTACTTACTCAAAAAATTTTGTAAACTTCCAGAAAATTATTAAAGCTTA
AAAAGTCAAGTTAAACAAATAGTCTAAAGCGAGAATAAAGCTAATTAATAAAGTTGTGAA
AATCTATTTAACTCCTTATATGACACAGAAATAAGCTACAAGCAAATAACTAATTTTTTG
AGATAAATAATCCAAAATTGTGTACCAAATTAATTACTTGGTAAAAAAAACTTCAAAGTG
TTCTTAGAGAAGTTATATGAGTTTGTCCAGATGAAGAGATTTGAAAATCAAAAGGTACTT
GATTACATTTGCTTTATGGATGTGTTTGATGTTGAGTGGTTTGTAGATTTAAAGAACCAA
AAGTTTACTTAAAAAAGAAAGTATATTTCTGATAAAAGAAAGATTCTAGGAGACTTGATA
GTTTTTATAATCAACAAAATCGTTATTCCTGTTCTCAGGTATAATTTTTACATAACTGAG
AAACACAAGGAAGGAAGTCAAATATTCTATTACCGTAAACCAATATGGAAATTAGTGAGT
AAATTAACTATTGTCAAACTTGAAGAGGAGAATTTGGAAAAAGTTGAAGAAAAATTGATA
CCAGAAGATTCATTTTAGAAATACCCTCAAGGAAAGCTAAGGATTATACCTAAAAAAGGA
TCTTTCCGTCCAATCATGACTTTCTTAAGAAAGGACAAGCAAAAAAATATTAAGTTAAAT
CTAAATTAAATTCTAATGGATAGCCAACTTGTGTTTAGGAATTTAAAAGACATGCTGGGA
TAAAAGATAGGATATTCAGTCTTTGATAATAAACAAATTTCAGAAAAATTTGCCTAATTC
ATAGAGAAATGGAAAAATAAAGGAAGACCTCAGCTATATTATGTCACTCTAGATATTAAA
AAGTGTTATGACTCTATCGACTAAATGAAACTTTTAAACTTCTTTAATCAAAGTGACCTA
ATTCAAGATACTTATTTTATAAATAAATATTTACTGTTTTAGAGAAATAAGCGCCCACTC
TTACAAATTTAGCAAACAAATAATTTAAACAGTGCTATGGAAATTGAAGAGGAAAAAATA
AACAAAAAACCTTTTAAAATGGATAATATTAATTTTCCATATTACTTTAATTTGAAAGAG
AGACAGATTGCCTACAGTTTGTATGATGACGATGATTAAATTTTATAAAAGGGGTTTAAA
GAAATTTAATCTGATGATAGACCATTTATTGTAATCAATTAAGATAAACCAAGATGCATA
ACAAAAGATATTATACATAATCACTTGAAACATATCAGCTAGTATAATGTTATCAGTTTT
AATAAAGTTAAATTTAGATAGAAAAGAGGTATTCCATAAGGTTTAAATATATCAGGAGTC
CTTTGCTCATTTTACTTTGGTAAGTTAGAGGAAGAATACACTTAATTCCTAAAAAATGCT
GAGTAGGTTAATGGCAGCATCAATTTACTTATGAGATTAACTGACGACTATTTGTTTATA
TCAGACTCTCAATAAAATGCATTAAATTTGATTGTACAACTCTAAAACTGTGCAAATAAT
AATGGATTTATGTTTAATGATTAAAAAATTACCACAAATTTTTAGTTTCCTTAGGAAGAC
TACAATTTAGAGCATTTTAAAATAAGTGTTTAGAATGAGTGCTAATGGATAGGGAAAAGC
ATAGACATGAACACATTAGAAATCAAATCTATATAAAAATAAACACAATAAGAAATAAAC
CAAACAATCAACGTAGCTATTTCTATAAAGAATTTAAAATCATAACTTAAAAACAAACTT
AGAAGTTTATTTTTAAATTAACTAATCGATTACTTCAACCCAAATATTAATTCTTTTGAG
GGTCTTTGCAGATAGCTATATCACCACAGCAAAGCTACAGTTATGAAATTCTATCCTTTC
ATGACTAAATTATTTTAAATTGATCTTAAAAAGTCAAAACAATATTCAGTTTAGTATGGA
AAAGAAAATACAAATGAAAATTTTCTTAAAGATATACTATATTACACAGTTGAAGATGTT
TGCAAAATATTATGCTATCTATAATTTGAAGACGAAATTAATTCAAATATAAAAGAAATC
TTCAAAAATTTATACTCATGGATTATGTGGGATATCATTGTTAGCTATTTGAAAAAGAAA
AAGCAATTTAAGGGATATCTAAACAAATTACTACAAAAGATAAGAAAGTCCAGGTTTTTC
TATCTTAAAGAAGGTTGCAAAAGTTTGTAATTGATACTTTCATAGCAAAAATATTAATTA
AATAAAAAAGAATTAGAGGCTATTGAATTCATAGATTTAAATAACCTCATATAAGACATT
AAGACACTGATACCTAAAATTTCAGCTAAATCTAATTAATAAAATACCAATTGA


>TTHERM_00112560(protein)
MQKINNINNNKQMLTRKEDLLTVLKQISALKYVSNLYEFLLATEKIVQTSELDTQFQEFL
TTTIIASEQNLVENYKQKYNQPNFSQLTIKQVIDDSIILLGNKQNYVQQIGTTTIGFYVE
YENINLSRQTLYSSNFRNLLNIFGEEDFKYFLIDFLVFTKVEQNGYLQVAGVCLNQYFSV
QVKQKKWYKNNFNMNGKATSNNNQNNANLSNEKKQENQYIYPEIQRSQIFYCNHMGREPG
VFKSSFFNYSEIKKGFQFKVIQEKLQGRQFINSDKIKPDHPQTIIKKTLLKEYQSKNFSC
QEERDLFLEFTEKIVQNFHNINFNYLLKKFCKLPENYQSLKSQVKQIVQSENKANQQSCE
NLFNSLYDTEISYKQITNFLRQIIQNCVPNQLLGKKNFKVFLEKLYEFVQMKRFENQKVL
DYICFMDVFDVEWFVDLKNQKFTQKRKYISDKRKILGDLIVFIINKIVIPVLRYNFYITE
KHKEGSQIFYYRKPIWKLVSKLTIVKLEEENLEKVEEKLIPEDSFQKYPQGKLRIIPKKG
SFRPIMTFLRKDKQKNIKLNLNQILMDSQLVFRNLKDMLGQKIGYSVFDNKQISEKFAQF
IEKWKNKGRPQLYYVTLDIKKCYDSIDQMKLLNFFNQSDLIQDTYFINKYLLFQRNKRPL
LQIQQTNNLNSAMEIEEEKINKKPFKMDNINFPYYFNLKERQIAYSLYDDDDQILQKGFK
EIQSDDRPFIVINQDKPRCITKDIIHNHLKHISQYNVISFNKVKFRQKRGIPQGLNISGV
LCSFYFGKLEEEYTQFLKNAEQVNGSINLLMRLTDDYLFISDSQQNALNLIVQLQNCANN
NGFMFNDQKITTNFQFPQEDYNLEHFKISVQNECQWIGKSIDMNTLEIKSIQKQTQQEIN
QTINVAISIKNLKSQLKNKLRSLFLNQLIDYFNPNINSFEGLCRQLYHHSKATVMKFYPF
MTKLFQIDLKKSKQYSVQYGKENTNENFLKDILYYTVEDVCKILCYLQFEDEINSNIKEI
FKNLYSWIMWDIIVSYLKKKKQFKGYLNKLLQKIRKSRFFYLKEGCKSLQLILSQQKYQL
NKKELEAIEFIDLNNLIQDIKTLIPKISAKSNQQNTN


>TTHERM_00112560(gene)
ATGTAGAAAATTAACAATATTAATAATAATAAATAAATGTTAACCAGAAAAGAAGATTTG
CTAACTGTTTTAAAATAAATCTCTGCTCTAAAGTATGTTTCAAATTTGTATGAATTTTTG
TTAGCAACAGAAAAAATAGTACAAACAAGTGAGCTTGATACATAGTTTTAGTAAGATTAT
TAATCATAAATAACAAATATTAAAGGACACATTCAATTAATTATAGAGAGTTTTTAACAA
CAACTATAATTGCGAGCGAGTAAAATTTAGTTGAAAACTACAAGCAAAAATACAACCAAC
CTAACTTCAGTTAACTGACCATTAAATAAGTAATATGTTAACTAAATACAGCTATAATTA
AACCTTTTTCAATTAGGTTATCGATGATAGCATTATTTTGCTAGGAAACAAATAAAATTA
TGTACAGTAAATAGGGACAACAACTATTGGCTTTTATGTTGAATATGAAAATATTAATCT
TTCAAGACAAACTCTCTATTCTTCAAATTTTAGAAATCTTTTAAATATCTTCGGAGAAGA
AGATTTTAAATATTTTTTAATAGATTTTTTGGTAATCAATCAATAATTTTTTGATAATTC
TACTTATTAAATTAAAAAATATCTTACTAAATTTTGTAGTAAAATTTTATTTCAAATTGA
AAAGTAATAAATAATGAATCTATTAATCTAAAAAATGGATATTTTAAAGGAAATAATTTG
CATCATTAGCAAATAACTGAGTACAATCATTATTTATATTTATTAAAATCATATTTTTTA
TTGTTAATATTAAATTGAAACCTTTTATGTTTAATTTAAATATTAAATTTTTGTAAATAT
TGATTGATATATTTATTTTATTAAAGGTATTCACTAAAGTAGAATAAAATGGCTATTTAC
AGGTAGCAGGAGTCTGTTTGAATTAATATTTTTCTGTTTAAGTTAAATAAAGTAAATTGA
AAATTATTTAATTTAACGACTAAGCAAAAATATTTATTAAATAATTTAGAAAAATGGTAT
AAAAATAACTTTAATATGAATGGTAAAGCTACAAGTAATAATAATCAAAATAATGCTAAT
CTTAGCAATGAGAAAAAGTAAGAAAATCAGTACATTTATCCTGAAATTTAGAGATCATAA
ATATTCTATTGCAATCATATGGGAAGAGAACCAGGAGTTTTTAAATCAAGTATTATTTAT
TTGAAATACATAAAAATATAAATAAAAAATTAATTTTACGTAGGTTTTTTCAACTACTCA
GAGATAAAAAAGGGTTTTTAATTCAAAGTAATTTAAGAAAAACTGCAAGGAAGATAATTT
ATTAATTCAGATAAAATAAAACCTGACCACCCTCAAACTATTATTAAAAAAACTTTGTTG
AAGGAATATCAAAGCAAAAATTTTTCGTGCTAAGAGTAAATTAAATATTTTAAAAATAGC
TATTTATTTTAATATTGTTATAAATTATAGAGAAAGAGATTTATTTTTAGAATTTACAGA
AAAAATTGTGCAGAACTTTCATAATATCAACTTCAATTACTTACTCAAAAAATTTTGTAA
ACTTCCAGAAAATTATTAAAGCTTAAAAAGTCAAGTTAAACAAATAGTCTAAAGCGAGAA
TAAAGCTAATTGTAAAATTTATTCATTTTTTTAATCTGTTTTAATTTAGATGTATTAAAA
AGAATAAAGTTGTGAAAATCTATTTAACTCCTTATATGACACAGAAATAAGCTACAAGCA
AATAACTAATTTTTTGAGATAAATAATCCAAAATTGTGTACCAAATTAATTACTTGGTAA
AAAAAACTTCAAAGTGTTCTTAGAGAGTAAATATTTTATAATTTATCTACAAAGTAATTA
TTTGGTTTTTAATTTTTTGTATGTTAATTAGAGTTATATGAGTTTGTCCAGATGAAGAGA
TTTGAAAATCAAAAGGTACTTGATTACATTTGCTTTATGGATGTGTTTGATGTTGAGTGG
TTTGTAGATTTAAAGAACCAAAAGTTTACTTAAAAAAGAAAGTATATTTCTGATAAAAGA
AAGATTCTAGGAGACTTGATAGTTTTTATAATCAACAAAATCGTTATTCCTGTTCTCAGG
TATAATTTTTACATAACTGAGAAACACAAGGAAGGAAGTCAAATATTCTATTACCGTAAA
CCAATATGGAAATTAGTGAGTAAATTAACTATTGTCAAAGTAAGAATTTAGTTTTCTGAA
AAGAATAAATAAATGAAAAATAATTTTTATCAAAAAATTTAGCTTGAAGAGGAGAATTTG
GAAAAAGTTGAAGAAAAATTGATACCAGAAGATTCATTTTAGAAATACCCTCAAGGAAAG
CTAAGGATTATACCTAAAAAAGGATCTTTCCGTCCAATCATGACTTTCTTAAGAAAGGAC
AAGCAAAAAAATATTAAGTTAAATCTAAATTAAATTCTAATGGATAGCCAACTTGTGTTT
AGGAATTTAAAAGACATGCTGGGATAAAAGATAGGATATTCAGTCTTTGATAATAAACAA
ATTTCAGAAAAATTTGCCTAATTCATAGAGAAATGGAAAAATAAAGGAAGACCTCAGCTA
TATTATGTCACTCTAGATATTAAAAAGTGTTATGACTCTATCGACTAAATGAAACTTTTA
AACTTCTTTAATCAAAGTGACCTAATTGTAATTTATTTTAAAAAAATTAATTAATTTTTA
TAGTTTGTTATAATAAATAGCAAGATACTTATTTTATAAATAAATATTTACTGTTTTAGA
GAAATAAGCGCCCACTCTTACAAATTTAGCAAACAAATAATTTAAGTAAAATTATTTCAA
ATTAATTTTAAAAACTGAAATTAAAAAATTTTCACGAAATTAATATTTATTAGACAGTGC
TATGGAAATTGAAGAGGAAAAAATAAACAAAAAACCTTTTAAAATGGATAATATTAATTT
TCCATATTACTTTAATTTGAAAGAGAGACAGATTGCCTACAGTTTGTATGATGACGATGA
TTAAATTTTATAAAAGGGGTTTAAAGAAATTTAATCTGATGATAGACCATTTATTGTAAT
CAATTAAGATAAACCAAGATGCATAACAAAAGATATTATACATAATCACTTGAAACATAT
CAGCTAGTATAATGTTATCAGTGTAAAAAAATTATTATATTTTTGAAAAAATTTGATTTT
AAATCCTTCAAAATTATTAATTGATTAAAATTCTTATTGATTGATTGATAATTTTGGAGA
TTTGCATTTCATTTGTGAGCTTATTTTCCATATTTTTAATTTTTTTATTAGTTTAATAAA
GTTAAATTTAGATAGAAAAGAGGTATTCCATAAGGTTTAAATATATCAGGAGTCCTTTGC
TCATTTTACTTTGGTAAGTTAGAGGAAGAATACACTTAATTCCTAAAAAATGCTGAGTAG
GTTAATGGCAGCATCAATTTACTTATGAGATTAACTGACGACTATTTGTTTATATCAGAC
TCTCAATAAAATGCATTAAATTTGATTGTACAACTCTAAAACTGTGCAAATAATAATGGA
TTTATGTTTAATGATTAAAAAATTACCACAAATTTTTAGTTTCCTTAGGAAGACTACAAT
TTAGAGCATTTTAAAATAAGTGTTTAGAGTATTTTTTTTATTAAAAATAATAAATTAAAA
ATGAAAATGAAATATTTAAAAAGATGAGTGCTAATGGATAGGGAAAAGCATAGACATGAA
CACATTAGAAATCAAATCTATATAAAAATAAACACAATAAGGTAAATTAACTTAATCTAT
GAAAGAATTACTTTTTAAAATATACTTAATTATAATCATTTTTATAAAATCACTAAATTA
GAAATAAACCAAACAATCAACGTAGCTATTTCTATAAAGAATTTAAAATCATAACTTAAA
AACAAACTTAGAAGGTAAAAATGAAATTTGAATGTTAAATTTGTTAAAATAGATTTATTT
TTATAAAAAGTTTATTTTTAAATTAACTAATCGATTACTTCAACCCAAATATTAATTCTT
TTGAGGGTCTTTGCAGATAGCTATATCACCACAGCAAAGTAATTTCTTAAGGAATAAAAA
TTTTAAGACATTTAATATATATTATAAAAATCAACAGGCTACAGTTATGAAATTCTATCC
TTTCATGACTAAATTATTTTAAATTGATCTTAAAAAGTCAAAACAATATTCAGTTTAGTA
TGGAAAAGAAAATACAAATGAAAATTTTCTTAAAGGTAATTTAAATTTTTGAAAAAAAAG
ATTATTTTTAATTTTTTTATCTGCTAGATATACTATATTACACAGTTGAAGATGTTTGCA
AAATATTATGCTATCTATAATTTGAAGACGAAATTAATTCAAATATAAAAGAAATCTTCA
AAAATTTATACTCATGGTAATAATTTAAATACACTTATTTTATTTATTTTTATTTCATCA
TTAATTGCTTGCATAACACTAATTAGGATTATGTGGGATATCATTGTTAGCTATTTGAAA
AAGAAAAAGCAATTTAAGGGATATCTAAACAAATTACTACAAAAGATAAGAAAGTCCAGG
TTTTTCTATCTTAAAGAAGGTTGCAAAAGTTTGTAATTGATACTTTCATAGCAAAAATAT
TAATTAAATAAAAAAGAATTAGAGGCTATTGAATTCATAGATTTAAATAACCTCATATAA
GACATTAAGACACTGATACCTAAAATTTCAGCTAAATCTAATTAATAAAATACCAATTGA