Identifiers and Description

Gene Model Identifier

TTHERM_00997620

Standard Name

TER1 (Tetrahymena Endoplasmic reticulum Retrieval receptor)

Aliases

PreTt24987 | 188.m00063

Description

Putative ER-retrevial receptor; transcription of TER1 induced following exocytosis; may be cargo protein of dense core secretory granules

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

  • ( PF04193 ) PQ loop repeat
  • ( PF00810 ) ER lumen protein retaining receptor

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 37%

TetraMine Data

TTHERM_00997620

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17840.14.001709789838121e-126hypothetical protein (218 aa)
OxytrichaContig16185.0.g841.9991517704232713e-32ER lumen protein retaining rec
eptor
Stentor CoeruleusSteCoe_17211.9287498479639178e-22
DictyBaseDDB_G02721240.000000000003001226732525078kdelr on chromosome: 2 positio
n 1376821 to 1377729
WormBaseWBGene000013310.000000000008998169033602767locus:erd-2 ER lumen protein
retaining receptor status:C
onfirmed UniProt:P48583 pr
otein_id:CAA90056.2
SGDYBL040C0.00000019998969434520019ERD2 HDEL receptor, an integra
l membrane protein that binds
to the HDEL motif in proteins
destined for retention in the
endoplasmic reticulum; has a r
ole in maintenance of normal l
evels of ER-resident proteins

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:12707780: Petcherskaia M, McGuire JM, Pherson JM, Kirk KE (2003) Loss of cap structure causes mitotic defect in Tetrahymena thermophila telomerase mutants. Chromosoma 111(7):429-37
  2. Ref:12456006: Haddad A, Bowman GR, Turkewitz AP (2002) New class of cargo protein in Tetrahymena thermophila dense core secretory granules. Eukaryotic cell 1(4):583-93
  3. Ref:10518620: Hargrove BW, Bhattacharyya A, Domitrovich AM, Kapler GM, Kirk K, Shippen DE, Kunkel GR (1999) Identification of an essential proximal sequence element in the promoter of the telomerase RNA gene of Tetrahymena thermophila. Nucleic acids research 27(21):4269-75

Sequences

>TTHERM_00997620(coding)
ATGGAGCTAGTACTTTTATTATTCTTATTAGGATACGTAATTTAAGATGCAGGCTGCGTA
ATTTTACTTCTAAGAATATTGAAGCAAAGGTCTGTTGATGGTTTATCTCTTTAATCCCAA
GTTATGTACGGATTAGGAACATTAATGAGAGTAATCTACACTTTCGATACAAGACTAAGC
AATTACACAATTGTATTTGTTGAAATGATGGTTGCTGTTTTACTCCACATAGGCATACTT
TATGGTTTCTTCAAGTACAGATACACTCAAACTTCAGATATTTAATCTCCTTTAATTAGC
TGGAAAACAATAATACCCGTATGTTCAGTTTTAGCTTACTTTTTCCATCCAGGTGAATAG
TATGAATATCTACAAATTTTAGTATCTCTATCCATGTTTATTGAAGCAGTAGGTCTCCTA
CCATAAATTTATGTAAATCGCAAGCAAGGACGTGTAGAATATGAATTAGGAAAATATCTC
ATTTTTATGGTTGCAAGCAGAATAGCAAGATTAGCATTTTGGTTTGTAATGTATAGAATG
GGTGATTAAAATATTGAATTGATGGTTGCTGATATTGTTCATACAGTTCTTCTTGCAGAT
TTTGCAATTCTTTTTATTAAAAACAAAGGCAAAGAAGTTATCTTAGTAATTTGA


>TTHERM_00997620(protein)
MELVLLLFLLGYVIQDAGCVILLLRILKQRSVDGLSLQSQVMYGLGTLMRVIYTFDTRLS
NYTIVFVEMMVAVLLHIGILYGFFKYRYTQTSDIQSPLISWKTIIPVCSVLAYFFHPGEQ
YEYLQILVSLSMFIEAVGLLPQIYVNRKQGRVEYELGKYLIFMVASRIARLAFWFVMYRM
GDQNIELMVADIVHTVLLADFAILFIKNKGKEVILVI


>TTHERM_00997620(gene)
ATGGAGCTAGTACTTTTATTATTCTTATTAGGATACGTAATTTAAGATGCAGGCTGCGTA
ATTTTACTTCTAAGAATATTGAAGCAAAGGTCTGTTGATGGTTTATCTCTTTAATCCCAA
GTTATGTACGGATTAGGAACATTAATGAGAGTAATCTACACTTTCGATACAAGACTAAGC
AATTACACAATTGTATTTGTTGAAATGATGGTTGCTGTTTTACTCCACATAGGCATACTT
TATGGTTTCTTCAAGTACAGATACACTCAAACTTCAGATATTTAATCTCCTTTAATTAGC
TGGAAAACAATAATACCCGTATGTTCAGTTTTAGCTTACTTTTTCCATCCAGGTGAATAG
TATGAATATCTACAAATTTTAGTATCTCTATCCATGTTTATTGAAGCAGTAGGTCTCCTA
CCATAAATTTATGTAAATCGCAAGCAAGGACGTGTAGAATATGAATTAGGAAAATATCTC
ATTTTTATGGTTGCAAGCAGAATAGCAAGATTAGCATTTTGGTTTGTAATGTATAGAATG
GGTGATTAAAATATTGAATTGATGGTTGCTGATATTGTTCATACAGTTCTTCTTGCAGAT
TTTGCAATTCTTTTTATTAAAAACAAAGGCAAAGAAGTTATCTTAGTAATTTGA