Identifiers and Description

Gene Model Identifier

TTHERM_00218760

Standard Name

TEB1 (Telomerase DNA binding subunit 1; also known as Teloemrase- (or TERT-) associated protein of 82 kDa )

Aliases

PreTt22303 | 18.m00329 | 3701.m00089

Description

Telomerase holoenzyme subunit p82; essential gene; knockdown induces telomere shortening

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08792 ) A2L zinc ribbon domain
  • ( PF01336 ) OB-fold nucleic acid binding domain
  • ( PF08646 ) Replication factor-A C terminal domain
  • ( TIGR00617 ) replication factor-a protein 1 (rpa1)
  • ( TIGR00161 ) conserved hypothetical protein TIGR00161

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00218760

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06651.19.997093137033517e-262hypothetical protein (690 aa)
OxytrichaContig13699.0.g100.00008003872323201264Replication factor-A C termina
l domain
SGDYAR007C0.00020003864201578029RFA1 Subunit of heterotrimeric
Replication Protein A (RPA),
which is a highly conserved si
ngle-stranded DNA binding prot
ein involved in DNA replicatio
n, repair, and recombination

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25225329: Upton HE, Hong K, Collins K (2014) Direct single-stranded DNA binding by Teb1 mediates the recruitment of Tetrahymena thermophila telomerase to telomeres. Molecular and cellular biology 34(22):4200-12
  2. Ref:23918804: Hong K, Upton H, Miracco EJ, Jiang J, Zhou ZH, Feigon J, Collins K (2013) Tetrahymena telomerase holoenzyme assembly, activation, and inhibition by domains of the p50 central hub. Molecular and cellular biology 33(19):3962-71
  3. Ref:20363756: Min B, Collins K (2010) Multiple mechanisms for elongation processivity within the reconstituted tetrahymena telomerase holoenzyme. The Journal of biological chemistry 285(22):16434-43

Sequences

>TTHERM_00218760(coding)
ATGAAATTAACTAAAGGTGGGTCGTATATACTTAAAAAAGTGGACAGAAAATAGTTTTAT
TAAGATGAAGAAATAGTCATGTAAATAAAAAAAATACTTGGTTAAAAAACTACAGATTGC
AAACAATACATAAAATGTGAGTGTATAGATGGTTTGGGAGATGAAGCATTGATTTACTTT
GAGATGCTTGCTAATTAAAATCAGCATTTACAAAAAAACGATGTCATAATGATTTAAGAT
TATTTAAATGATAAAACATAAAACGACAAAATAGTTGTTTTAGTTACAAGGTTTTAATTT
TGTAAAGCCAGTCATGTTTAGCCTAAAACCGCCCAAAAAGAATCCATATAACTATTAAAT
ACTGAAAAAACAATAATTTAAAAGAGTAAAATTACTAAAAATCCAGCTGAAGAAGTTTTA
AAATTTATAGAAGTAAACGAAAAAGATAATAGTTCAAACAGTGAAGATATGATAATTGAA
TAGTAGAAATAAGAAATTAAGAATAATTAAAAAGAAAAACAAAGTATAAATGGATTTAAT
TTGGAAGATAGCTATTCAAATATTTCTGATATTACTAATTTTGGAGGGAAATCTAATTTT
AATATTGGATCACTTTCTGATTAACTTAGTAAATAGACACTGCTAATTTCTTAGTTGTAA
GTAGGTAAAAATAGATTTTCTTTTAAGTTCGAAGGAAGAGTTGTATATAAAAGTAGTACA
TTCCAGAATTAGCAAGACTCTAAGTATTTTTTCATCACAGCATAAGACGCTAATAATTAA
GAAATTAATTTGTCTTTTTGGCAAAAAGTTGATTAAAGCTATTAAACTTTGAAAGTAGGA
TAATATTATTACTTTATAGGAGGAGAAGTTAAATAGTTCAAAAATAATCTAGAATTAAAA
TTTAAGTTTGGAGACTACTAAATAATTCCTAAAGAGACTCTTTCTGCGAATTATGTATAA
CCTTTGGCATTACAACCTTCAAAATAATTTGGAAATGACTCAATAGGAGACTCTGATTAT
TCTATTCATAATTTAATTGAAAAGGAGGAAAGCATCGCTTAAAAGGGCTATAATGGATAA
AAGAATAATAAATATAGATAAAATAACAATAATAGCAAGCATACACTCTTAATATCTGAA
GTATTAAAAACTTCTAAATAATATTTATCAGTATTAGCATAAGTTGTTGATATTCAAAGT
TCAGATAAAAATATAAGATTAAAAATATGTGATAATAGCTGTAATTAAGAACTCAAAGTA
GTCATTTTTCCAGATTTATGCTATGAGTGGAGAGATAAATTTAGTATAAATAAATGGTAT
TATTTTAATGAGTTTGTTAGATAAATTTATAATGATGAAGTTTAGTTGAAAAATAACATT
CATTCTTCAATTAAAGAATCTGATGATTAAAGAAAAGTTATTACTTATAATTAAGAATAG
GGTGTTTTTAAAAAATCAATCTCAATTAATAGCAATGATAGTTTTGAAATTAAGCCTAAA
ATTTCATATAAAAACAATTCTAACTAAGAATAAAGGATTTATTCTTCAATTGAAGAAATA
ATCTAATAAGCATAGGCTTCAGAAATAGGTCAAAAAAAAGAATTCTATGTTTATGGAAAC
TTAGTTTCAATATAGATGAAAAATAAGCTTTATTATTATAGGTGTACTTGTTAGGGTAAG
TCAGTCTTAAAATATCACGGAGATTCATTTTTTTGTGAAAGTTGCTAGTAGTTCATAAAT
CCTTAGGTGCATTTGATGCTTAGAGCATTTGTTTAAGATTCTACAGGGACAATTCCTGTT
ATGATTTTCGATCAGCAGTCAAGCCAACTTATCAACTAAATTGATCCATCAATTCATGTC
TAAGAAGCAGGTTAATATGTTAAAAATTGTATTGAAAATGGATAAGAAGAAATTATAAGA
TAGTTATTTAGTAAATTAGACTTTGCTAGATTTATATTTGAAATTTAATTTGAAAATAAA
GAATTTAATAACGAATAAGAGATAGCATACAAAGTATTAAAAATTGAAAAAGAAAATATT
AAAGAAGAATCTAAATATCTACTAAAAAAGTTAGAGCACTTAATAAACAATAATCAAAAT
AACTGA


>TTHERM_00218760(protein)
MKLTKGGSYILKKVDRKQFYQDEEIVMQIKKILGQKTTDCKQYIKCECIDGLGDEALIYF
EMLANQNQHLQKNDVIMIQDYLNDKTQNDKIVVLVTRFQFCKASHVQPKTAQKESIQLLN
TEKTIIQKSKITKNPAEEVLKFIEVNEKDNSSNSEDMIIEQQKQEIKNNQKEKQSINGFN
LEDSYSNISDITNFGGKSNFNIGSLSDQLSKQTLLISQLQVGKNRFSFKFEGRVVYKSST
FQNQQDSKYFFITAQDANNQEINLSFWQKVDQSYQTLKVGQYYYFIGGEVKQFKNNLELK
FKFGDYQIIPKETLSANYVQPLALQPSKQFGNDSIGDSDYSIHNLIEKEESIAQKGYNGQ
KNNKYRQNNNNSKHTLLISEVLKTSKQYLSVLAQVVDIQSSDKNIRLKICDNSCNQELKV
VIFPDLCYEWRDKFSINKWYYFNEFVRQIYNDEVQLKNNIHSSIKESDDQRKVITYNQEQ
GVFKKSISINSNDSFEIKPKISYKNNSNQEQRIYSSIEEIIQQAQASEIGQKKEFYVYGN
LVSIQMKNKLYYYRCTCQGKSVLKYHGDSFFCESCQQFINPQVHLMLRAFVQDSTGTIPV
MIFDQQSSQLINQIDPSIHVQEAGQYVKNCIENGQEEIIRQLFSKLDFARFIFEIQFENK
EFNNEQEIAYKVLKIEKENIKEESKYLLKKLEHLINNNQNN


>TTHERM_00218760(gene)
AATAAATTAGCCAGTTTTTTGCAAAATTTTCAAAAACAAATATCTAAAAAGATAAATAGA
TAAAATTTAATTTTTTGTTTGGTAGAAATTACTATAATTCTAACAAACTAAAATAAAAAA
CAATTTACATTTTTTACTTTTAGATATAAAAACAAATCATAAATTAAAAGAAATTTTTCA
AGATAAAGTAAAAACTTTAAAACAATATTTTAAAGCCACTCCTAAATTTTAAAAGAAATG
AAATTAACTAAAGGTGGGTCGTATATACTTAAAAAAGTGGACAGAAAATAGTTTTATTAA
GATGAAGAAATAGTCATGTAAATAAAAAAAATACTTGGTTAAAAAACTACAGATTGCAAA
CAATACATAAAGTAATCAAAATATATAACTTATCTAAAAAGAAAACAAATTGAGAATAAA
AAAAATACAAATATAGATGTGAGTGTATAGATGGTTTGGGAGATGAAGCATTGATTTACT
TTGAGATGCTTGCTAATTAAAATCAGCATTTACAAAAAAACGATGTCATAATGATTTAAG
ATTATTTAAATGATAAAACATAAAAGTAAACTTTTAATATTAAAATGAGATAACAAAATT
AATAAATATTTTTAAAAATCAAGCGACAAAATAGTTGTTTTAGTTACAAGGTTTTAATTT
TGTAAAGCCAGTCATGTTTAGCCTAAAACCGCCCAAAAAGAATCCATATAACTATTAAAT
ACTGAAAAAACAATAATTTAAAAGAGTAAAATTACTAAAAATCCAGCTGAAGAAGTAATT
AGTAGCTTATTTGCAAAGCTGAATGAATATATTATTTTTACATTGAATATATTATTTTTA
CGAAATATTTTAGGTTTTAAAATTTATAGAAGTAAACGAAAAAGATAATAGTTCAAACAG
TGAAGATATGATAATTGAATAGTAGAAATAAGAAATTAAGAATAATTAAAAAGAAAAACA
AAGTATAAATGGTATTATTTATTTATTTATTAATCAATCTATCAATAATTTAATTTGAAA
ATTTTGAGTGAAAAATCCTTGATAAATTTTTTGAACCACTTAGAATTTCTTTGAATATGA
TTTTTTTGTTTTTGATTAGGATTTAATTTGGAAGATAGCTATTCAAATATTTCTGATATT
ACTAATTTTGGAGGGAAATCTAATTTTAATATTGGATCACTTTCTGATTAACTTAGTAAA
TAGACACTGCTAATTTCTTAGTTGTAAGTAGGTAAAAATAGATTTTCTTTTAAGTTCGAA
GGAAGAGTTGTATATAAAAGTAGTACATTCCAGAATTAGCAAGACTCTAAGTATTTTTTC
ATCACAGCATAAGACGCTAATAATTAAGAAATTAATTTGTCTTTTTGGCAAAAAGTTGAT
TAAAGCTATTAAACTTTGAAAGTAGGATAATATTATTACTTTATAGGAGGAGAAGTTAAA
TAGTTCAAAAATAAGTTAATTTATTTCTTTTTTTTTTTTAATTTAAATAAAATTTTATAT
TATAAAAATAGTCTAGAATTAAAATTTAAGTTTGGAGACTACTAAATAATTCCTAAAGAG
ACTCTTTCTGCGAATTATGTATAACCTTTGGCATTACAACCTTCAAAATAATTTGGAAAT
GACTCAATAGGAGACTCTGATTATTCTATTCATAATTTAATGTAAAAGTATTTATTAAAA
TCAATTTGTTTTGATATTTTTATGAACTTTTTTATAGTGAAAAGGAGGAAAGCATCGCTT
AAAAGGGCTATAATGGATAAAAGAATAATAAATATAGATAAAATAACAATAATAGCAAGC
ATACACTCTTAATATCTGAAGTATTAAAAACTTCTAAATAATATTTATCAGTATTAGCAT
AAGTTGTTGTAAGATAATTACTAAGAGGTTTATATGTAGGTATTAATATGTATTTTATTT
TAAATGAATAGGATATTCAAAGTTCAGATAAAAATATAAGATTAAAAATATGTGATAATA
GCTGTAATTAAGAACTCAAAGTAGTCATTTTTCCAGATTTATGCTATGAGTGGAGAGATA
AATTTAGTATAAATAAATGGTATTATTTTAATGAGTTTGTTAGATAAATTTATAATGATG
AAGTTTAGTTGAAAAATAACATTCATTCTTCAATTAAAGAATCTGATGATTAAAGAAAAG
TTATTACTTATAATTAAGAATAGGGTGTTTTTAAAAAATCAATCTCAATTAATAGCAATG
ATAGTTTTGAAATTAAGCCTAAAATTTCATATAAAAACAATTCTAACTAAGAATAAAGGA
TTTATTCTTCAATTGAAGAAATAATCTAATAAGCATAGGCTTCAGAAATAGGTCAAAAAA
AAGAATTCTATGTTTATGGAAACTTAGTTTCAATATAGATGAAAAATAAGCTTTATTATT
ATAGGTGTACTTGTTAGGGTAAGTCAGTCTTAAAATATCACGGAGATTCATTTTTTTGTG
AAAGTTGCTAGTAGTTCATAAATCCTTAGGTGCATTTGATGCTTAGAGCATTTGTTTAAG
ATTCTACAGGGACAATTCCTGTTATGATTTTCGATCAGCAGTCAAGCCAACTTATCAACT
GTAAATTTTTTTGGAAAAAATTAAATAAATTCATAAAATATTTGTTAAATAGAAATTGAT
CCATCAATTCATGTCTAAGAAGCAGGTTAATATGTTAAAAATTGTATTGAAAATGGATAA
GAAGAAATTATAAGATAGTTATTTAGTAAATTAGACTTTGCTAGATTTATATTTGAAATT
TAATTTGAAAATAAAGAATTTAATAACGAATAAGAGATAGCATACAAAGTATTAAAAATT
GAAAAAGAAAATATTAAAGAAGAATCTAAATATCTACTAAAAAAGTTAGAGCACTTAATA
AACAATAATCAAAATAACTGA