Identifiers and Description

Gene Model Identifier

TTHERM_00427490

Standard Name

TDP2 (a member of the phospholipase D family )

Aliases

PreTt14085 | 47.m00280

Description

Endonuclease/Exonuclease/phosphatase family protein; homolog to human TDP2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR00195 ) exodeoxyribonuclease III
  • ( TIGR00633 ) exodeoxyribonuclease III (xth)
  • ( TIGR03395 ) sphingomyelin phosphodiesterase
  • ( PF03372 ) endonuclease/exonuclease/phosphatase family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.7%

TetraMine Data

TTHERM_00427490

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00147.19.995516318087232e-125endonuclease/Exonuclease/phosp
hatase (278 aa)
OxytrichaContig15140.0.g495.0020095550341075e-51Endonuclease/Exonuclease/phosp
hatase family
DictyBaseDDB_G02696920.000000100009565553302DDB_G0269692 on chromosome: 1
position 3337065 to 3338927

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00427490(coding)
ATGAATAATTTACATTAATATATTAGAGAATTACAAACATGCAAAATTGATAACAATTAA
TATAGCGTTATTTCTTAATAAGTAAAACTTGAAGGAATACAAAAACTGAAATTCATTTCT
TATAACGTTTGGTTTGATCAGCATAATTTTGTAGAAAGAAGTATAGAATTAAAAAAGATA
TTCTTGAATTATGATCCAGATTTCATATGTATGTAGGAAGTTACTCAGCCTTTTCTGATA
TAGCTAGCTCAAGACAAAGAAATATGCTAAAAATATTATTTTTCTTCACCTTTCGTAAAC
TAATATGATGTTTTCATTTTATCCAAATATCCAATATCTTTTAAGTAGATGTTTTTTCCA
AGTTAAATGGGTAGAAATCTCTTATTTGGTGAAATTAATATAAACAATAGAAAAATTGTG
ATAGGTACCACTCACTTAGAAAGCTTAAAAAATAATGATAATTATAGAATGGAATAGTTA
AAAATAATAAAAGAACTTTTATCAAGCTATGATGAAAGTATTTTTATGGGAGATTTTAAT
ATGTCAAAATTAAATGAGGAGTAAAGCATTCCAGAAAATTATATAGATATTTGGAAAGCA
CTTCATCCTAATGAGGAAGGACATACGATGTAAGCAAGTAAAAAATTTCCTTCAGTTCGC
TTTGACAGAGTCCTTTTACGGCAATCTACTTACTGGAGTCCTTCTCATATTGAAATTATA
GGCAAAGATCCTATACCTTATTATTAGAATCACTAAAAAAAGCAAATATACGAAATTGTT
ACTCCTTCAGATCATTATGGTCTTTATGCAGAGATATCTTTTAATTCTAAATGA


>TTHERM_00427490(protein)
MNNLHQYIRELQTCKIDNNQYSVISQQVKLEGIQKLKFISYNVWFDQHNFVERSIELKKI
FLNYDPDFICMQEVTQPFLIQLAQDKEICQKYYFSSPFVNQYDVFILSKYPISFKQMFFP
SQMGRNLLFGEININNRKIVIGTTHLESLKNNDNYRMEQLKIIKELLSSYDESIFMGDFN
MSKLNEEQSIPENYIDIWKALHPNEEGHTMQASKKFPSVRFDRVLLRQSTYWSPSHIEII
GKDPIPYYQNHQKKQIYEIVTPSDHYGLYAEISFNSK


>TTHERM_00427490(gene)
ATGAATAATTTACATTAATATATTAGAGAATTACAAACATGCAAAATTGATAACAATTAA
TATAGCGTTATTTCTTAATAAGTAAAACTTGAAGGAATACAAAAACTGAAATTCATTTCT
TATAACGTTTGGTTTGATCAGCATAATTTTGTAGAAAGAAGTATAGAATTAAAAAAGATA
TTCTTGAATTATGATCCAGATTTCATATGTATGTAGGAAGTTACTCAGCCTTTTCTGATA
TAGCTAGCTCAAGACAAAGAAATATGCTAAAAATATTATTTTTCTTCACCTTTCGTAAAC
TAATATGATGTTTTCATTTTATCCAAATATCCAATATCTTTTAAGTAGATGTTTTTTCCA
AGTTAAATGGGTAGAAATCTCTTATTTGGTGAAATTAATATAAACAATAGAAAAATTGTG
ATAGGTACCACTCACTTAGAAAGCTTAAAAAATAATGATAATTATAGAATGGAATAGTTA
AAAATAATAAAAGAACTTTTATCAAGCTATGATGAAAGTATTTTTATGGGAGATTTTAAT
ATGTCAAAATTAAATGAGGAGTAAAGCATTCCAGAAAATTATATAGATATTTGGAAAGCA
CTTCATCCTAATGAGGAAGGACATACGATGTAAGCAAGTAAAAAATTTCCTTCAGTTCGC
TTTGACAGAGTCCTTTTACGGCAATCTACTTACTGGAGTCCTTCTCATATTGAAATTATA
GGCAAAGATCCTATACCTTATTATTAGAATCACTAAAAAAAGCAAATATACGAAATTGTT
ACTCCTTCAGATCATTATGGTCTTTATGCAGAGATATCTTTTAATTCTAAATGA