Identifiers and Description

Gene Model Identifier

TTHERM_00723650

Standard Name

TDP1 (a member of the phospholipase D family )

Aliases

PreTt18125 | 116.m00150 | 3671.m00074

Description

Tyrosyl-DNA phosphodiesterase family protein; homolog to human TDP1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF08257 ) Sulfakinin family
  • ( PF06087 ) Tyrosyl-DNA phosphodiesterase
  • ( PF00614 ) phospholipase D active site domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00723650

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14839.19.997093137033517e-262tyrosyl-DNA phosphodiesterase
(580 aa)
OxytrichaContig18880.0.g202.99915080840225e-45Tyrosyl-DNA phosphodiesterase
Stentor CoeruleusSteCoe_193507.781132241133797e-20
DictyBaseDDB_G02738690.00000000019994075865167896DDB_G0273869 on chromosome: 2
position 3501162 to 3503366
WormBaseWBGene000186780.000000100009565553302status:Confirmed UniProt:U4P
RC2 protein_id:CDH93125.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00723650(coding)
ATGGAAGAAATAAGAAGTGATTTAATTTCTGAAAATAGCTTCGACTCACACAATAAAAGC
AGTAAAAAACGAGATTACAAATAATATTCTCAGTAGAATGAAGCTGAAGAATTTACTTTA
GGAGAGCTTGAAGAAAGGAATAAATTTAAATTATATAGCGAAAGAATATACTAAAATGAT
TCTATTGACTAAGCTCATTAAAATGTTTCTAAGAGCGAGTATACCTGCTTTCCTCCTATT
AAATTCAGATAAAACGAATAGTAAGAAAATTAACCTAAAAATAAATTGACTGATTTTTAC
ATGAATCAACTAGTGCATCATAAAAATCTGAAAACGAACAAGCATTTCATTAACTTTCGC
GCTCTATTTTATGAAGACCCTTTCTATAAAGAAAAAAATTTATGCCCGAAAAAGACCTTA
ATTTCTGCCTTTTTGACTACTAAAGGTTTAGATGAAGAACTTGTGCTTCCTTTAGTGAAG
GCAAATGTCAAAGTAGTTATTGCTGATGATAAGATAAAATAATGGAATGAGAAAAGAAAT
GTGATTAAAAATCATTAATATTTTGAAAATTTTACAATAGTTTATCCTCCAAAAGACTAT
CTTTCTAAAACTTGGGGTTGCTTTCATTCGAAATTGTGGATACTTAAATTCCCTAAATTT
CTTAGAATAGTGATTGGGACAGGAAATTTAAGAATTCTTCACTGGACTAACTGGTCAAAT
ATTATATGGTTTAAAGATTTTGAATTGATACCATAACAAATTTAAGTTTCTTAAAGCTTA
GACTATTTTAATAGTAATATCTCAATAGGATCTAAAGGAGTCAAAGTTGTTAATCTAGAA
AAAAATTATAGAAACATAAATGATGTAGATATGAATGAGGATTTTATAGATGTGCTTAAT
GAATTTATAGATAAAATATGTCCCTATTTTGATGTTAAGGAGATGCTTGATATTAATTTA
AGAAATTATTAAATAAAAGGAATTAATTTTATGCTTGTTTCCTCTCTTCCAGGAAAGTTT
TCAGGCTCTTAAATACATGATTATGGAAAGATGAGGATCAGAAAAATTTGTTAAGTATTC
AATCCAAGAAATATTGACTCAAAAAAAGTTCTATACTCTCAAAGCACTAGCTTAGGTACT
ATAGACAGAACCTTTGTTAATGAATTTTTGTTTTGCTTTTTACCTTATCAATTTTGCAGC
GAAATAGAGCTTAAAGATAAAGTGAAAAAAAATGACCCAGAAAAAAATGATGAAATTAGA
TTAATATTCCCTTCTAAGGATTATATTTAAAATAAAACTCTAGATGGAGCTGGCTATTCT
GATACTTTATTTTTAACTAGTAAAAGATACTAAAAAGAGTCTTTTCTTAAAAATATATTT
TACTAATTTTAATGCAAGTAAATGGATTCTTTGGGTGAATCCCAAGATAAACAAAAAGGA
ATTATTCCTCATTTTAAGACTATGATAGTCTGTGAGTAAAATGGAGAAATAAATGATGAT
TCAATCATTTATATTGGAAGTCATAATTTTTCTGAAGCAGCATGGGGAAAGCTAAATAAA
GATAATACTCAGCTTTACATAAGTAATACAGAATTAGGAATATTAATTCCACCCTTAAAA
GGATCGTAAGAAATAAAAGAAGAGATTATTGAAATAATGAATTATAAATTTCCAGCTAAG
CCGTATAGAGAAAAAGAAAAACCATATATTAGTGATATTGATCATCCAATATTTTAAAAA
TGA


>TTHERM_00723650(protein)
MEEIRSDLISENSFDSHNKSSKKRDYKQYSQQNEAEEFTLGELEERNKFKLYSERIYQND
SIDQAHQNVSKSEYTCFPPIKFRQNEQQENQPKNKLTDFYMNQLVHHKNLKTNKHFINFR
ALFYEDPFYKEKNLCPKKTLISAFLTTKGLDEELVLPLVKANVKVVIADDKIKQWNEKRN
VIKNHQYFENFTIVYPPKDYLSKTWGCFHSKLWILKFPKFLRIVIGTGNLRILHWTNWSN
IIWFKDFELIPQQIQVSQSLDYFNSNISIGSKGVKVVNLEKNYRNINDVDMNEDFIDVLN
EFIDKICPYFDVKEMLDINLRNYQIKGINFMLVSSLPGKFSGSQIHDYGKMRIRKICQVF
NPRNIDSKKVLYSQSTSLGTIDRTFVNEFLFCFLPYQFCSEIELKDKVKKNDPEKNDEIR
LIFPSKDYIQNKTLDGAGYSDTLFLTSKRYQKESFLKNIFYQFQCKQMDSLGESQDKQKG
IIPHFKTMIVCEQNGEINDDSIIYIGSHNFSEAAWGKLNKDNTQLYISNTELGILIPPLK
GSQEIKEEIIEIMNYKFPAKPYREKEKPYISDIDHPIFQK


>TTHERM_00723650(gene)
ATGGAAGAAATAAGAAGTGATTTAATTTCTGAAAATAGCTTCGACTCACACAATAAAAGC
AGTAAAAAACGAGATTACAAATAATATTCTCAGTAGAATGAAGCTGAAGAATTTACTTTA
GGAGAGCTTGAAGAAAGGAATAAATTTAAATTATATAGCGAAAGAATATACTAAAATGAT
TCTATTGACTAAGCTCATTAAAATGTTTCTAAGAGCGAGTATACCTGCTTTCCTCCTATT
AAATTCAGATAAAACGAATAGTAAGAAAATTAACCTAAAAATAAATTGACTGATTTTTAC
ATGAATCAACTAGTGCATCATAAAAATCTGAAAACGAACAAGCATTTCATTAACTTTCGC
GCTCTATTTTATGAAGACCCTTTCTATAAAGGTAGCACTAATTAAATATAGATTTTAAAA
ATTTAAAAGCATAATTATTTATTGGATATGAATTAATTTATTTATTATTATGCGGGTATT
TTAATTTTAAATCAATTTAAACAGAAAAAAATTTATGCCCGAAAAAGACCTTAATTTCTG
CCTTTTTGACTACTAAAGGTTTAGATGAAGAACTTGTGCTTCCTTTAGTGAAGGCAAATG
TCAAAGTAAGCTTCTCTTTATATTTTTCAAATTTAAAAATTTTTTTACTTTTACATAAAT
TAACAAAATACTAAAACTCTTTTTGTTTAAGAACGTTAAAAAATTTCAAAGTAATTTATA
AAATGCTTTATGAATAATTAAAATATTAAAAAGAAGTATTTCGAATTTAAAGTAAATTAA
TTTTTAAATTAATAGGTAGTTATTGCTGATGATAAGATAAAATAATGGAATGAGAAAAGA
AATGTGATTAAAAATCATTAATATTTTGAAAATTTTACAATAGTTTATCCTCCAAAAGAC
TATCTTTCTAAAACTTGGGGTTGCTTTCATTCGAAATTGTGGATACTTAAATTCCCTAAA
TTTCTTAGAATAGTGATTGGGACAGGAAATTTAAGAATTCTTCACTGGACTAACTGGTCA
AATATTATATGGTTTAAAGATTTTGAATTGATACCATAACAAATTTAAGTTTCTTAAAGC
TTAGACTATTTTAATAGTAATATCTCAATAGGATCTAAAGGAGTCAAAGTTGTTAATCTA
GAAAAAAATTATAGAAACATAAATGATGTAGATATGAATGAGGATTTTATAGATGTGCTT
AATGAATTTATAGATAAAATATGTCCCTATTTTGATGTTAAGGAGATGCTTGATATTAAT
TTAAGAAATTATTAAATAAAAGGAATTAATTTTATGCTTGTTTCCTCTCTTCCAGGAAAG
TTTTCAGGCTCTTAAATACATGATTATGGAAAGATGAGGATCAGAAAAATTTGTTAAGTA
TTCAATCCAAGAAATGTAAGTTAAGTTTTAATATTTTAGAATTAAATAGATATATATTGT
TATTTTATGTAAATAAAATTTTTAAATATCAAACTTAAATTATAATTAAATTAAATTGAA
ATTTGATAATTATTATTTATTTAATTAACTAATTAATGATTTGTATTAATTAAAATAAAT
ATATTTTTGTCAATAAATATTTTACTGCTTTACTTTACTTATTTATAATTTAAAAAATAT
AGATTGACTCAAAAAAAGTTCTATACTCTCAAAGCACTAGCTTAGGTACTATAGACAGAA
CCTTTGTTAATGAATTTTTGTTTTGCTTTTTACCTTATCAATTTTGCAGCGAAATAGAGC
TTAAAGATAAAGTGAAAAAAAATGACCCAGAAAAAAATGATGAAATTAGATTAATATTCC
CTTCTAAGGATTATATTTAAAATAAAACTCTAGATGGAGCTGGCTATTCTGATACTTTAT
TTTTAACTAGTAAAAGATACTAAAAAGAGTCTTTTCTTAAAAATATATTTTACTAATTTT
AATGCAAGTAAATGGATTCTTTGGGTGAATCCCAAGATAAACAAAAAGGAATTATTCCTC
ATTTTAAGACTATGATAGTCTGTGAGTAAAATGGAGAAATAAATGATGATTCAATCATTT
ATATTGGAAGGTTCAATACTTATTTTATTACTATTAAAAACTAAAAGATTAATTAATTTA
TTAAAATATCGATAAATTAGTCATAATTTTTCTGAAGCAGCATGGGGAAAGCTAAATAAA
GATAATACTCAGCTTTACATAAGTAATACAGAATTAGGAATATTAATTCCACCCTTAAAA
GGTAATGTTTAAATTTTAAATAAATAGATTGTCTTTAATTATTAAATTTAATAGCAAATG
AAATTTTTAAAAGTAATCCACCACAATTCTATAAATTAAATTAAATAAAAAGGCAACTAT
TAACATTTTTAATGCTTATTAGCTTACTCAATCATAAAAAATGCTTTAATTTAAGTAATT
TTGATATTTGAGGAATACAGTAAAAAAAATATTTTTTTAAGAATCTAAATTAATATTCAA
TTTTACGAAAGATTAAAATCAATTAGAATATTAAATTTGTAATTTGTAAAAACTAAAAGG
ATCGTAAGAAATAAAAGAAGAGATTATTGAAATAATGAATTATAAATTTCCAGCTAAGCC
GTATAGAGAAAAAGAAAAACCATATATTAGTGATATTGATCATCCAATATTTTAAAAATG
A