Identifiers and Description

Gene Model Identifier

TTHERM_00554190

Standard Name

TDH2 (glyceraldehyde-3-phosphate dehydrogenase)

Aliases

PreTt29226 | 72.m00149

Description

glyceraldehyde-3-phosphate dehydrogenase, type I family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR01532 ) D-erythrose-4-phosphate dehydrogenase
  • ( PF01113 ) Dihydrodipicolinate reductase, N-terminus
  • ( TIGR01534 ) glyceraldehyde-3-phosphate dehydrogenase, type I
  • ( PF02800 ) Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
  • ( PF00044 ) Glyceraldehyde 3-phosphate dehydrogenase, NAD binding

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 20.7%

TetraMine Data

TTHERM_00554190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07327.19.997093137033517e-262glyceraldehyde-3-phosphate deh
ydrogenase, type I family prot
ein (343 aa)
OxytrichaContig18741.0.g636.999124466619517e-162Glyceraldehyde 3-phosphate deh
ydrogenase, C-terminal domain
DictyBaseDDB_G02751533.000455015819344e-150gpdA on chromosome: 2 position
5324765 to 5325948
WormBaseWBGene000016862.000851114308011e-136locus:gpd-4 Glyceraldehyde-3
-phosphate dehydrogenase 4 s
tatus:Confirmed UniProt:P173
31 protein_id:CAA88697.1
SGDYJL052W1.0002323021920326e-132TDH1 Glyceraldehyde-3-phosphat
e dehydrogenase, isozyme 1, in
volved in glycolysis and gluco
neogenesis; tetramer that cata
lyzes the reaction of glyceral
dehyde-3-phosphate to 1,3 bis-
phosphoglycerate; detected in
the cytoplasm and cell wall
Stentor CoeruleusSteCoe_9783.5722699376192174e-67

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00554190(coding)
ATGTCTTTAAGAATAGGTATAAACGGATTTGGTAGAATAGGCAGATTAGTTTTAAGAGCT
GCTATTGAAAATAAATCTAATTTGATCACACCTGTTGCAATTAATGATCCTTCTATGGAT
ATTGATTATTTAATTTATTAATTAAAATATGACTCAGTTCATCTAAAATTTCCTGGCACT
ATTGAAAAGGTTAATGAACATACTGTTAAAATAAATGGAAATTCTATTGTCTTGTTTAAA
GAAAAGGATCCTGCTGCTTTAAAATGGGGTGAAGTGGGAGCTGATTTTATATGCGAGTCA
TCAGGATTATTTTTGACTTAAGATAAAGCTGGAGCTCACTTAAAAGGAGGTGCTAAGAAA
GTTATTTTATCAGCACCTTCTAAAGATGATACTCCTACTTATGTCTTTGGTGTCAATCAT
AATAATTATATACCTTCTTAAAATATCATTTCTAATGCCTCTTGCACTACAAATTGTTTA
GCAAATATCGCTAAGGTACTTGACTAAAATTTTGGTATAGTAGAAGGTTTAATGACAGCT
GTGCATGCTACAACAGCTTCTCAATAAGTGGTTGATGGTCCTTCAAAAGGAGGAAAAGAT
TGGAGAGCTGGAAGAGCTGCAAAGGTTAACATTATTCCTTCTTCTACAGGTGCTGCAAAA
GCTGTTGGTCTGGTTCTACCAAATCTTAAAGGAAAACTTACTGGGATGTCATTTAGAGTT
CCTACTATTGATGTGTCTGTAGTAGATCTAACTGTTAGACTTGAAAAAAAAACTACATAT
GCAAATATTTGTGAGGCTATGGAAGAAGCTTCTAAAGGTGAGCTTAATGGAATTTTAGGT
TATACAAAAGATGAAGTAGTATCTTAAGATTTCGTACATGATTAGAGAACTTCTATTTTT
GATTCAAAAGCAGGAATTGGTCTGAACAATAATTTTTTTAAAGTTGTATCTTGGTATGAT
AATGAATGGGGATTTTCAAACAAGCTTCTTGATTTAGCTTTGCATGTTTAAAAAACTTCA
GGATTATGA


>TTHERM_00554190(protein)
MSLRIGINGFGRIGRLVLRAAIENKSNLITPVAINDPSMDIDYLIYQLKYDSVHLKFPGT
IEKVNEHTVKINGNSIVLFKEKDPAALKWGEVGADFICESSGLFLTQDKAGAHLKGGAKK
VILSAPSKDDTPTYVFGVNHNNYIPSQNIISNASCTTNCLANIAKVLDQNFGIVEGLMTA
VHATTASQQVVDGPSKGGKDWRAGRAAKVNIIPSSTGAAKAVGLVLPNLKGKLTGMSFRV
PTIDVSVVDLTVRLEKKTTYANICEAMEEASKGELNGILGYTKDEVVSQDFVHDQRTSIF
DSKAGIGLNNNFFKVVSWYDNEWGFSNKLLDLALHVQKTSGL


>TTHERM_00554190(gene)
ATGTCTTTAAGAATAGGTATAAACGGATTTGGTAGAATAGGCAGATTAGTTTTAAGAGCT
GCTATTGAAAATAAATCTAATTTGATCACACCTGTTGCAATTAATGATCCTTCTATGGAT
ATTGATTATTTAATTTATTAATTAAAATATGACTCAGTTCATCTAAAATTTCCTGGCACT
ATTGAAAAGGTAGTTAGAATAATTACAATAATTTTAACAAATGCATAAAAATACCCTTCA
AATCTATATTTTAATGCTTATTTTTATTTTATTCTATTCTAATAAATTTACTTTGAATAA
TATATGCACTTAAACTTCAATTTAAGTTAAATTTTATCTGTTTTAATTTTATTTTTAAAT
AGGTTAATGAACATACTGTTAAAATAAATGGAAATTCTATTGTCTTGTTTAAAGAAAAGG
ATCCTGCTGCTTTAAAATGGGGTGAAGTGGGAGCTGATTTTATATGCGAGTCATCAGGAT
TATTTTTGACTTAAGATAAAGCTGGAGCTCACTTAAAAGGAGGTGCTAAGAAAGTTATTT
TATCAGCACCTTCTAAAGATGATACTCCTACTTATGTCTTTGGTGTCAATCATAATAATT
ATATACCTTCTTAAAATATCATTTCTAATGCCTCTTGCACTACAAATTGTTTAGCAAATA
TCGCTAAGGTACTTGACTAAAATTTTGGTATAGTAGAAGGTTTAATGACAGCTGTGCATG
CTACAACAGCTTCTCAATAAGTGGTTGATGGTCCTTCAAAAGGAGGAAAAGATTGGAGAG
CTGGAAGAGCTGCAAAGGTTAACATTATTCCTTCTTCTACAGGTGCTGCAAAAGCTGTTG
GTCTGGTTCTACCAAATCTTAAAGGAAAACTTACTGGGATGTCATTTAGAGTTCCTACTA
TTGATGTGTCTGTAGTAGATCTAACTGTTAGACTTGAAAAAAAAACTACATATGCAAATA
TTTGTGAGGCTATGGAAGAAGCTTCTAAAGGTGAGCTTAATGTAATTTATTATTTATTTG
TCTCCCTTTTTAATTTGTTTAAATACATTAAAATTAAAAAGGGAATTTTAGGTTATACAA
AAGATGAAGTAGTATCTTAAGATTTCGTACATGATTAGAGAACTTCTATTTTTGATTCAA
AAGCAGGAATTGGTCTGAACAATAATTTTTTTAAAGTTGTATCTTGGTATGATAATGAAT
GGGGATTTTCAAACAAGCTTCTTGATTTAGCTTTGCATGTTTAAAAAACTTCAGGATTAT
GA